Property Summary

NCBI Gene PubMed Count 27
PubMed Score 14.44
PubTator Score 43.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 1.8e-02
ependymoma 1.500 4.8e-02
lung adenocarcinoma -1.200 1.2e-16
lung carcinoma -1.300 1.2e-07
non-small cell lung carcinoma -1.100 1.0e-22
osteosarcoma -1.023 1.9e-04
psoriasis -1.100 1.5e-03

 OMIM Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (20)

AA Sequence

MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMQNQRVLVTSVPHAMTGSDVLQWIVQRLWISSLEA      1 - 70
QNLGNFIVRYGYIYPLQDPKNLILKPDGSLYRFQTPYFWPTQQWPAEDTDYAIYLAKRNIKKKGILEEYE     71 - 140
KENYNFLNQKMNYKWDFVIMQAKEQYRAGKERNKADRYALDCQEKAYWLVHRCPPGMDNVLDYGLDRVTN    141 - 210
PNEVKVNQKQTVVAVKKEIMYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQF    211 - 280
WDLNAKLVEIPTKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKA    281 - 350
EEIYKLFLAPGARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKDMLAKA    351 - 420
IEPQETTKKSSTLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQPGQHMAPSPHLTVYTGTCMPP    421 - 490
SPSSPFSSSCRSPRKPFASPSRFIRRPSTTICPSPIRVALESSSGLEQKGECSGSMAPRGPSVTESSEAS    491 - 560
LDTSWPRSRPRAPPKARMALSFSRFLRRGCLASPVFARLSPKCPAVSHGRVQPLGDVGQQLPRLKSKRVA    561 - 630
NFFQIKMDVPTGSGTCLMDSEDAGTGESGDRATEKEVICPWESL                              631 - 674
//

Text Mined References (29)

PMID Year Title