Property Summary

NCBI Gene PubMed Count 27
Grant Count 190
R01 Count 148
Funding $20,071,070.72
PubMed Score 14.60
PubTator Score 43.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 0.018
posterior fossa group A ependymoma 2.400 0.000
psoriasis -1.100 0.002
osteosarcoma -1.023 0.000
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.300 0.000
non-small cell lung carcinoma -1.100 0.000

Synonym

Accession O75916 A8K3C0 O75573 Q696R2 Q8TD64 Q8TD65 Q9HC32 Q9HC33 RGS9
Symbols PERRS
RGS9L

Gene

PANTHER Protein Class (2)

 OMIM Term (1)

Gene RIF (20)

PMID Text
26345773 To identify single-nucleotide polymorphisms that contribute to the genetic susceptibility to schizophrenia, we examined the potential association between schizophrenia and 9 single nucleotide polymorphisms in the G-protein signaling 9 gene
25591550 These findings indicate a role for RGS9 gene polymorphisms in heroin dependence and may be informative for future genetic or biological studies on heroin dependence.
23857581 the GAP activity of RGS9-2 showed a strong receptor preference for D2R over MOR. Finally, RGS7 displayed an four times greater GAP activity relative to RGS9-2.
22132185 These studies with humans, rats and mice implicate RGS9-2 as a factor in regulating body weight.
22006018 beta-Arrestin2 is required for the inhibition of D3R signaling by RGS9-2.
21511947 Type 5 G protein beta subunit (Gbeta5) controls the interaction of regulator of G protein signaling 9 (RGS9) with membrane anchors
20627871 Observational study of gene-disease association. (HuGE Navigator)
20477943 The expression of RGS9-2 inhibits dopamine-mediated cellular internalization of the dopamine 2 (D2) receptor.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20374717 The main goal of this review is to illustrate how various functions are fulfilled through the interplay between the intrinsic molecular properties of RGS9 isoforms.
More...

AA Sequence

MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMQNQRVLVTSVPHAMTGSDVLQWIVQRLWISSLEA      1 - 70
QNLGNFIVRYGYIYPLQDPKNLILKPDGSLYRFQTPYFWPTQQWPAEDTDYAIYLAKRNIKKKGILEEYE     71 - 140
KENYNFLNQKMNYKWDFVIMQAKEQYRAGKERNKADRYALDCQEKAYWLVHRCPPGMDNVLDYGLDRVTN    141 - 210
PNEVKVNQKQTVVAVKKEIMYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQF    211 - 280
WDLNAKLVEIPTKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKA    281 - 350
EEIYKLFLAPGARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKDMLAKA    351 - 420
IEPQETTKKSSTLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQPGQHMAPSPHLTVYTGTCMPP    421 - 490
SPSSPFSSSCRSPRKPFASPSRFIRRPSTTICPSPIRVALESSSGLEQKGECSGSMAPRGPSVTESSEAS    491 - 560
LDTSWPRSRPRAPPKARMALSFSRFLRRGCLASPVFARLSPKCPAVSHGRVQPLGDVGQQLPRLKSKRVA    561 - 630
NFFQIKMDVPTGSGTCLMDSEDAGTGESGDRATEKEVICPWESL                              631 - 674
//

Text Mined References (29)

PMID Year Title
26345773 2015 Regulators of G-protein signaling 9 genetic variations in Chinese subjects with schizophrenia.
25591550 2015 Evidence for the contribution of genetic variations in regulator of G protein signaling 9 to the genetic susceptibility of heroin dependence.
23857581 2013 Macromolecular composition dictates receptor and G protein selectivity of regulator of G protein signaling (RGS) 7 and 9-2 protein complexes in living cells.
22132185 2011 Association between regulator of G protein signaling 9-2 and body weight.
22006018 2011 ?-arrestin2 plays permissive roles in the inhibitory activities of RGS9-2 on G protein-coupled receptors by maintaining RGS9-2 in the open conformation.
21511947 2011 Type 5 G protein beta subunit (Gbeta5) controls the interaction of regulator of G protein signaling 9 (RGS9) with membrane anchors.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20477943 2010 RGS9-2 mediates specific inhibition of agonist-induced internalization of D2-dopamine receptors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20374717 2009 Biology and functions of the RGS9 isoforms.
More...