Property Summary

NCBI Gene PubMed Count 52
PubMed Score 86.97
PubTator Score 105.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.188 3.5e-02
lung cancer -1.400 2.0e-04
malignant mesothelioma -3.400 2.5e-08
medulloblastoma, large-cell -1.600 8.3e-06
Multiple myeloma 1.217 4.7e-02
nephrosclerosis 1.010 1.0e-04
osteosarcoma 1.448 4.0e-04
ovarian cancer -1.900 4.7e-06
pancreatic cancer 1.300 3.6e-03
Parkinson's disease -1.400 8.7e-03
primary pancreatic ductal adenocarcinoma 1.228 3.3e-03
Waldenstrons macroglobulinemia 1.210 2.2e-02

Gene RIF (38)

AA Sequence

MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGG      1 - 70
IVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLR     71 - 140
LRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE                          141 - 188
//

Text Mined References (58)

PMID Year Title