Property Summary

NCBI Gene PubMed Count 50
PubMed Score 83.61
PubTator Score 105.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 2.5084055910391E-8
ovarian cancer 8492 2.45396734237105E-6
medulloblastoma, large-cell 6234 8.28462156238607E-6
nephrosclerosis 329 1.03139514266222E-4
lung cancer 4473 2.0315019035643E-4
osteosarcoma 7933 4.03353639056338E-4
primary pancreatic ductal adenocarcinoma 1271 0.00328482658457135
pancreatic cancer 2300 0.00363025015822231
Parkinson's disease 364 0.00874012093113765
Waldenstrons macroglobulinemia 765 0.0222408939049883
aldosterone-producing adenoma 664 0.0345289265391427
Multiple myeloma 1328 0.046582095359632

Expression

  Differential Expression (12)

Disease log2 FC p
nephrosclerosis 1.010 0.000
Waldenstrons macroglobulinemia 1.210 0.022
Multiple myeloma 1.217 0.047
malignant mesothelioma -3.400 0.000
osteosarcoma 1.448 0.000
medulloblastoma, large-cell -1.600 0.000
primary pancreatic ductal adenocarcinoma 1.228 0.003
lung cancer -1.400 0.000
Parkinson's disease -1.400 0.009
aldosterone-producing adenoma -1.188 0.035
ovarian cancer 2.700 0.000
pancreatic cancer 1.300 0.004

Synonym

Accession O75915 B2R6V5 Q53ES3 Q5KU08
Symbols JWA
jmx
hp22
PRAF3
Yip6b
DERP11
HSPC127
addicsin
GTRAP3-18

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (36)

PMID Text
26046674 JWA and topoisomerase II alpha regulate each other in tumor cells arrested in G2/M.
25586271 the JWA gene may regulate human breast cancer cells through the MAPK signaling pathway using different types of regulation.
25476899 JWA reverses cisplatin resistance via the CK2-XRCC1 pathway in human gastric cancer cells.
24157826 JWA has an important role in ING4-regulated melanoma angiogenesis, and ING4/JWA/ILK are promising prognostic markers and may be used as anti-angiogenic therapeutic targets for melanoma.
24072772 Loss of JWA expression was strongly correlated with increased gastric cancer angiogenesis.
24064223 A significant negative correlation between JWA and ILK in melanoma biopsies.
23461062 JWA plays an important role in the occurrence and progress of human esophageal squamous cell carcinoma (ESCC) and that high expression level of JWA may predict a favorable prognosis in ESCC patients.
23285001 A combined effect of p53 with JWA as efficient prognostic indicators was found for the first time.
23169062 data demonstrate that JWA plays a crucial role in HCC progression and suggest JWA may be a potential prognostic biomarker and therapeutic target for HCC.
23109897 This review gives an overview of EAAC1-mediated GSH synthesis, and its regulatory mechanisms by GTRAP3-18 in the brain, and a potential approach against neurodegeneration.
More...

AA Sequence

MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGG      1 - 70
IVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLR     71 - 140
LRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE                          141 - 188
//

Text Mined References (56)

PMID Year Title
26046674 2015 EGCG regulates the cross-talk between JWA and topoisomerase II? in non-small-cell lung cancer (NSCLC) cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25586271 2015 Effects of the JWA gene in the regulation of human breast cancer cells.
25476899 2014 JWA reverses cisplatin resistance via the CK2-XRCC1 pathway in human gastric cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24157826 2013 ING4 regulates JWA in angiogenesis and their prognostic value in melanoma patients.
24072772 2014 JWA suppresses tumor angiogenesis via Sp1-activated matrix metalloproteinase-2 and its prognostic significance in human gastric cancer.
24064223 2013 JWA inhibits melanoma angiogenesis by suppressing ILK signaling and is an independent prognostic biomarker for melanoma.
23461062 2012 Downregulation of JWA expression in human esophageal squamous cell carcinoma and its clinical significance.
More...