Property Summary

NCBI Gene PubMed Count 56
PubMed Score 20.29
PubTator Score 44.86

Knowledge Summary

Patent (19,308)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 1.05348093151228E-44
Breast cancer 3099 1.85007503983246E-44
psoriasis 6685 2.16167107519478E-36
glioblastoma multiforme 347 5.20859907821585E-20
oligodendroglioma 2849 1.87521628604387E-10
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.78438546332654E-6
pituitary cancer 1972 5.33459276498985E-6
pancreatic cancer 2300 3.27776470727532E-5
atypical teratoid / rhabdoid tumor 4369 7.40892872715615E-5
Atopic dermatitis 944 8.65590484988986E-5
primary pancreatic ductal adenocarcinoma 1271 1.19980170564135E-4
invasive ductal carcinoma 2950 3.72355060098994E-4
medulloblastoma, large-cell 6234 5.36622499010972E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.36788529515825E-4
ovarian cancer 8492 9.96087170978604E-4
pilocytic astrocytoma 3086 0.00106262117400683
cystic fibrosis 1670 0.00222151473606893
astrocytic glioma 2241 0.00267963614605474
adult high grade glioma 2148 0.00489354209333548
ependymoma 2514 0.014030974051501
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0256923091441593
medulloblastoma 1524 0.0358059413255087
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 4.846 2.4
Disease Target Count
Mental retardation, X-linked 30 1

Expression

  Differential Expression (22)

Synonym

Accession O75914 A8K389 B1GX77 B1GX78 B1GX79 Q5JWX1 Q5JWX2 Q7Z2D6 Q7Z2E4 Q7Z3Z8 Q8WWK5 Q8WX23 Q9P0J8
Symbols ARA
bPAK
MRX30
MRX47
OPHN3
PAK-3
PAK3beta
beta-PAK

Gene

  Ortholog (11)

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (13)

PMID Text
25981171 This study showed that PARK3 messenger RNA levels was significantly upregulated in subjects with schizophrenia in laminar and cellular samples.
25666757 This study identified predicted pathogenic, hemizygous variants on chromosome X in disease genes PAK3.
25596744 Data show that group I p21-activated kinases (Paks) Pak1 and Pak2 were much more abundant than Pak3 in meningioma.
25109462 Cdc42Hs binds to the effector domain of PAK3
23818969 Results show elevated PAK3 expression at both the mRNA and protein level in cJun/AP-1-over-expressing Rat1a fibroblasts, as well as in transformed human fibroblasts.
23622267 Group I p21-activated kinases augment Tax-mediated transcriptional activation of human T-cell leukemia virus type 1 long terminal repeats in a kinase-independent manner.
21949127 p21-Activated kinase 3 (PAK3) protein regulates synaptic transmission through its interaction with the Nck2/Grb4 protein adaptor.
20960100 potential role of PAK3 in the progression of ACTH-producing thymic carcinoid
18805672 Observational study of gene-disease association. (HuGE Navigator)
18523455 PAK3 mutations result in a specific form of X-linked mental retardation with fairly constant clinical features.
More...

AA Sequence

MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEI      1 - 70
SLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKF     71 - 140
YDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRP    141 - 210
EHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPK    211 - 280
KKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVG    281 - 350
DELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD    351 - 420
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIA    421 - 490
TNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR     491 - 559
//

Text Mined References (58)

PMID Year Title
25981171 2015 Altered expression of CDC42 signaling pathway components in cortical layer 3 pyramidal cells in schizophrenia.
25666757 2015 Whole-exome sequencing points to considerable genetic heterogeneity of cerebral palsy.
25596744 2015 Group I Paks as therapeutic targets in NF2-deficient meningioma.
25109462 2014 Dynamic and thermodynamic response of the Ras protein Cdc42Hs upon association with the effector domain of PAK3.
24184505 2014 A novel long non-coding RNA-ARA: adriamycin resistance-associated.
23818969 2013 p21-activated kinase 3 (PAK3) is an AP-1 regulated gene contributing to actin organisation and migration of transformed fibroblasts.
23622267 2013 Group I p21-activated kinases facilitate Tax-mediated transcriptional activation of the human T-cell leukemia virus type 1 long terminal repeats.
21949127 2011 p21-Activated kinase 3 (PAK3) protein regulates synaptic transmission through its interaction with the Nck2/Grb4 protein adaptor.
21177870 2011 Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway.
21115725 2011 p21-Activated kinases 1 and 3 control brain size through coordinating neuronal complexity and synaptic properties.
More...