Property Summary

Ligand Count 5
NCBI Gene PubMed Count 57
PubMed Score 21.08
PubTator Score 44.86

Knowledge Summary

Patent (19,308)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Mental Retardation, X-Linked 30 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
lung cancer 4740 0.0 0.5

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -2.100 3.3e-03
astrocytic glioma -1.500 3.0e-03
Astrocytoma, Pilocytic -1.500 1.5e-03
Atopic dermatitis -1.300 8.7e-05
atypical teratoid / rhabdoid tumor -2.900 1.2e-05
Breast cancer -2.300 5.3e-36
cystic fibrosis 1.100 2.2e-03
ependymoma -1.900 1.1e-02
glioblastoma -2.000 1.2e-05
group 4 medulloblastoma -1.400 3.4e-02
intraductal papillary-mucinous adenoma (... -1.100 2.7e-02
intraductal papillary-mucinous carcinoma... -2.700 8.1e-05
intraductal papillary-mucinous neoplasm ... -2.400 5.0e-04
invasive ductal carcinoma -1.300 1.3e-03
lung carcinoma 3.900 1.1e-44
medulloblastoma, large-cell -3.000 5.0e-03
oligodendroglioma -1.700 1.3e-02
ovarian cancer 1.100 2.5e-05
pancreatic cancer -1.600 7.7e-05
pituitary cancer 1.100 1.7e-06
primary pancreatic ductal adenocarcinoma -1.801 1.2e-04
psoriasis -1.300 2.2e-36

Gene RIF (14)

AA Sequence

MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEI      1 - 70
SLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKF     71 - 140
YDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRP    141 - 210
EHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPK    211 - 280
KKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVG    281 - 350
DELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD    351 - 420
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIA    421 - 490
TNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR     491 - 559
//

Text Mined References (59)

PMID Year Title