Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $22,952
PubMed Score 8.70
PubTator Score 5.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.632 0.004
ependymoma -1.500 0.000
glioblastoma -1.800 0.001
group 4 medulloblastoma -2.800 0.000
cystic fibrosis -1.061 0.001
atypical teratoid / rhabdoid tumor -1.800 0.004
medulloblastoma, large-cell -2.800 0.000
pediatric high grade glioma -1.400 0.004
Breast cancer -1.600 0.000
ovarian cancer -1.200 0.000

Synonym

Accession O75912 A4D1Q9 Q9NZ49 DAG kinase iota
Symbols DGK-IOTA

Gene

PANTHER Protein Class (2)

 Grant Application (1)

 MGI Term (1)

Gene RIF (4)

PMID Text
25233099 the DGKI methylation status identified 22% of poorly responding patients in the low-risk group
21203819 Here, we report results from a fine-mapping approach involving linkage and association analysis in Finnish and German dyslexic cohorts. We restrict a candidate region to 0.3 Mb on chromosome 7q33.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19065143 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MDAAGRGCHLLPLPAARGPARAPAAAAAAAASPPGPCSGAACAPSAAAGAGAMNPSSSAGEEKGATGGSS      1 - 70
SSGSGAGSCCLGAEGGADPRGAGSAAAAGAAALDEPAAAGQKEKDEALEEKLRNLTFRKQVSYRKAISRA     71 - 140
GLQHLAPAHPLSLPVANGPAKEPRATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKC    141 - 210
AVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKE    211 - 280
IVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKA    281 - 350
SKRGMEQENKGRPFVIKPISSPLMKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALEL    351 - 420
YRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVE    421 - 490
DGTVVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRN    491 - 560
KMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNPGDHHDFE    561 - 630
PQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQAN    631 - 700
MVQKSKRRTSMPLLNDPQSVPDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIP    701 - 770
LGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLH    771 - 840
FVMEISQDEIFILDPDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLGMIAPYYEDSDL    841 - 910
KDLSHSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHCSLLHYAAKTGNGEIVKYILD    911 - 980
HGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGASLRKTDSKGKTPQERAQQAGDPDLAAYLESR    981 - 1050
QNYKVIGHEDLETAV                                                          1051 - 1065
//

Text Mined References (14)

PMID Year Title
25233099 2014 DGKI methylation status modulates the prognostic value of MGMT in glioblastoma patients treated with combined radio-chemotherapy with temozolomide.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24468470 2014 Genetic susceptibility to accelerated cognitive decline in the US Health and Retirement Study.
21502085 2011 Genome-wide association study implicates PARD3B-based AIDS restriction.
21203819 2011 SNP variations in the 7q33 region containing DGKI are associated with dyslexia in the Finnish and German populations.
21119615 2011 DGK? regulates presynaptic release during mGluR-dependent LTD.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19065143 2009 Gene-wide analyses of genome-wide association data sets: evidence for multiple common risk alleles for schizophrenia and bipolar disorder and for overlap in genetic risk.
17986458 2007 A yeast two-hybrid system reconstituting substrate recognition of the von Hippel-Lindau tumor suppressor protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...