Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.70
PubTator Score 5.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 7.9e-03
atypical teratoid / rhabdoid tumor -1.800 4.1e-03
Breast cancer -1.300 2.0e-32
cystic fibrosis -1.061 5.6e-04
ependymoma -1.500 1.1e-04
glioblastoma -1.400 3.3e-04
group 3 medulloblastoma -1.100 3.9e-02
medulloblastoma, large-cell -1.500 5.5e-04
osteosarcoma 1.632 3.5e-03
ovarian cancer -1.200 2.2e-05

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MDAAGRGCHLLPLPAARGPARAPAAAAAAAASPPGPCSGAACAPSAAAGAGAMNPSSSAGEEKGATGGSS      1 - 70
SSGSGAGSCCLGAEGGADPRGAGSAAAAGAAALDEPAAAGQKEKDEALEEKLRNLTFRKQVSYRKAISRA     71 - 140
GLQHLAPAHPLSLPVANGPAKEPRATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKC    141 - 210
AVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKE    211 - 280
IVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKA    281 - 350
SKRGMEQENKGRPFVIKPISSPLMKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALEL    351 - 420
YRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVE    421 - 490
DGTVVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRN    491 - 560
KMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNPGDHHDFE    561 - 630
PQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQAN    631 - 700
MVQKSKRRTSMPLLNDPQSVPDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIP    701 - 770
LGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLH    771 - 840
FVMEISQDEIFILDPDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLGMIAPYYEDSDL    841 - 910
KDLSHSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHCSLLHYAAKTGNGEIVKYILD    911 - 980
HGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGASLRKTDSKGKTPQERAQQAGDPDLAAYLESR    981 - 1050
QNYKVIGHEDLETAV                                                          1051 - 1065
//

Text Mined References (14)

PMID Year Title