Property Summary

NCBI Gene PubMed Count 16
Grant Count 16
R01 Count 15
Funding $998,177.62
PubMed Score 13.24
PubTator Score 18.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -7.600 0.000
osteosarcoma -1.145 0.045
astrocytoma 1.200 0.048
medulloblastoma, large-cell -1.200 0.000
tuberculosis -2.100 0.000
lung cancer -1.300 0.002
breast carcinoma -1.600 0.000
fibroadenoma -1.900 0.005
interstitial cystitis -1.300 0.000
pilocytic astrocytoma 1.100 0.000
posterior fossa group B ependymoma 1.300 0.000
subependymal giant cell astrocytoma 1.214 0.009
lung carcinoma -1.600 0.000
spina bifida 1.207 0.043
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -1.100 0.009
ovarian cancer 1.300 0.000
pituitary cancer -1.900 0.000

Gene RIF (5)

PMID Text
24733397 Data indicate that retinaldehyde reductase (DHRS3) requires retinol dehydrogenase 10 (RDH10) for full enzymatic activity and, in turn, activates RDH10.
21659514 p53-Inducible DHRS3 is an endoplasmic reticulum protein associated with lipid droplet accumulation.
20543567 The retSDR1 is identified as novel transcriptional target of the p53 family and not transactivated by EEC syndrome-specific mutations of TAp63gamma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676742 CST6, CXCL14, DHRS3, and SPP1 are regulated by BRAF signaling and may play a role in papillary thyroid carcinoma pathogenesis

AA Sequence

MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAERGARKIVLWG      1 - 70
RTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL     71 - 140
LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCP    141 - 210
GVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQA    211 - 280
ALEEIHKFSGTYTCMNTFKGRT                                                    281 - 302
//

Text Mined References (19)

PMID Year Title
24733397 2014 The retinaldehyde reductase activity of DHRS3 is reciprocally activated by retinol dehydrogenase 10 to control retinoid homeostasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21659514 2011 p53-Inducible DHRS3 is an endoplasmic reticulum protein associated with lipid droplet accumulation.
20543567 2010 The retinal dehydrogenase/reductase retSDR1/DHRS3 gene is activated by p53 and p63 but not by mutants derived from tumors or EEC/ADULT malformation syndromes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18676742 2008 Gene expression profiling of papillary thyroid carcinoma identifies transcripts correlated with BRAF mutational status and lymph node metastasis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...