Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.73
PubTator Score 18.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.200 4.8e-02
Astrocytoma, Pilocytic 1.100 3.3e-04
breast carcinoma -1.600 3.6e-04
ductal carcinoma in situ -1.500 3.5e-04
fibroadenoma -1.900 4.8e-03
interstitial cystitis -1.100 4.0e-03
invasive ductal carcinoma -1.100 9.3e-03
lung cancer -1.300 2.2e-03
lung carcinoma -1.600 1.1e-13
malignant mesothelioma -7.600 4.7e-09
medulloblastoma, large-cell -1.200 2.3e-04
osteosarcoma -1.145 4.5e-02
ovarian cancer 1.300 2.2e-04
pituitary cancer -1.900 1.4e-08
posterior fossa group A ependymoma 1.100 3.8e-05
spina bifida 1.207 4.3e-02
subependymal giant cell astrocytoma 1.214 8.5e-03
tuberculosis -2.100 1.3e-06

Synonym

Accession O75911 B2R7F3 Q5VUY3 Q6UY38 Q9BUC8
Symbols SDR1
RDH17
Rsdr1
DD83.1
SDR16C1
retSDR1

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAERGARKIVLWG      1 - 70
RTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL     71 - 140
LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCP    141 - 210
GVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQA    211 - 280
ALEEIHKFSGTYTCMNTFKGRT                                                    281 - 302
//

Text Mined References (21)

PMID Year Title