Property Summary

NCBI Gene PubMed Count 22
PubMed Score 18.45
PubTator Score 19.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 6.3e-09
psoriasis 6694 6.5e-06
osteosarcoma 7950 3.5e-05
pancreatic cancer 2398 1.2e-03
primary pancreatic ductal adenocarcinoma 1109 9.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.121 3.5e-05
ovarian cancer -1.400 6.3e-09
pancreatic cancer 1.500 1.2e-03
primary pancreatic ductal adenocarcinoma 1.241 9.3e-03
psoriasis -2.900 6.5e-06

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDT      1 - 70
LATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEV     71 - 140
MVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAV    141 - 210
MYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQ    211 - 280
PTPQVPQVQQSQPSQSSEPSQPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEP    281 - 350
PPPKIPKIETTHPPLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRP    351 - 420
PPPPPSSYMTGMSTTSSYMSGEGYQSLQSMMKTEGPSYGALPPAYGPPAHLPYHPHVYPPNPPPPPVPPP    421 - 490
PASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPPVPP    491 - 560
PIPPPGMPPVGGLGRAAWMR                                                      561 - 580
//

Text Mined References (32)

PMID Year Title