Property Summary

NCBI Gene PubMed Count 22
PubMed Score 15.31
PubTator Score 19.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.900 0.000
osteosarcoma -1.121 0.000
primary pancreatic ductal adenocarcinoma 1.241 0.009
ovarian cancer 1.700 0.000
pancreatic cancer 1.500 0.001

Synonym

Accession O75909 Q59FT6 Q86U16 Q96B63 Q9NNY9
Symbols CPR4

Gene

PDB

4CXA   4NST   4UN0   5ACB   2I53   5EFQ  

 MGI Term (1)

Gene RIF (14)

PMID Text
26597175 Structures of CDK12/CycK complexes solved in the presence of AMP-PNP.
25712099 Data show that most mutations prevent formation of the cyclin-dependent kinase 12 (Cdk12)/cyclin K (CycK) complex, rendering the kinase inactive.
25004108 that cyclin K may be a novel molecular link between germ cell development, cancer development and embryonic stem cell maintenance.
25004108 Cyclin K is highly expressed in mammalian testes in a developmentally regulated manner.
22988298 Cyclin K1 is the primary cyclin partner for CDK12/CrkRS and it is required for activation of CDK12/CrkRS to phosphorylate the C-terminal domain of RNA Pol II.
22547058 Cyclin K interacts with CDK12 and CDK13 but not CDK9 in cells, and is required to maintain self-renewal in ES cells.
21555514 Cyclin K inhibits HIV-1 gene expression and replication by interfering with cyclin-dependent kinase 9 (CDK9)-cyclin T1 interaction in Nef-dependent manner.
21555514 HIV-1 Nef induces cyclin K interaction with CDK9, which contributes to inhibit CDK9 nuclear translocation
21555514 HIV-1 Nef induces cyclin K interaction with CDK9, which contributes to inhibit CDK9 nuclear translocation
20930849 These results reveal an unexpectedly direct role for CDK9-cyclin K in checkpoint pathways that maintain genome integrity in response to replication stress.
More...

AA Sequence

MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDT      1 - 70
LATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEV     71 - 140
MVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAV    141 - 210
MYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQ    211 - 280
PTPQVPQVQQSQPSQSSEPSQPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEP    281 - 350
PPPKIPKIETTHPPLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRP    351 - 420
PPPPPSSYMTGMSTTSSYMSGEGYQSLQSMMKTEGPSYGALPPAYGPPAHLPYHPHVYPPNPPPPPVPPP    421 - 490
PASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPPVPP    491 - 560
PIPPPGMPPVGGLGRAAWMR                                                      561 - 580
//

Text Mined References (32)

PMID Year Title
26748711 2016 Structural and Functional Analysis of the Cdk13/Cyclin K Complex.
26597175 2015 Structures of the CDK12/CycK complex with AMP-PNP reveal a flexible C-terminal kinase extension important for ATP binding.
25712099 2015 Ovarian carcinoma CDK12 mutations misregulate expression of DNA repair genes via deficient formation and function of the Cdk12/CycK complex.
25416956 2014 A proteome-scale map of the human interactome network.
25004108 2014 A distinct expression pattern of cyclin K in mammalian testes suggests a functional role in spermatogenesis.
24662513 2014 The structure and substrate specificity of human Cdk12/Cyclin K.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22988298 2012 Interaction of cyclin-dependent kinase 12/CrkRS with cyclin K1 is required for the phosphorylation of the C-terminal domain of RNA polymerase II.
22547058 2012 Cyclin K-containing kinase complexes maintain self-renewal in murine embryonic stem cells.
More...