Property Summary

Ligand Count 93
NCBI Gene PubMed Count 33
PubMed Score 40.47
PubTator Score 27.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 2.500 3.9e-04
malignant mesothelioma -1.400 1.9e-04

Gene RIF (21)

AA Sequence

MEPGGARLRLQRTEGLGGERERQPCGDGNTETHRAPDLVQWTRHMEAVKAQLLEQAQGQLRELLDRAMRE      1 - 70
AIQSYPSQDKPLPPPPPGSLSRTQEPSLGKQKVFIIRKSLLDELMEVQHFRTIYHMFIAGLCVFIISTLA     71 - 140
IDFIDEGRLLLEFDLLIFSFGQLPLALVTWVPMFLSTLLAPYQALRLWARGTWTQATGLGCALLAAHAVV    141 - 210
LCALPVHVAVEHQLPPASRCVLVFEQVRFLMKSYSFLREAVPGTLRARRGEGIQAPSFSSYLYFLFCPTL    211 - 280
IYRETYPRTPYVRWNYVAKNFAQALGCVLYACFILGRLCVPVFANMSREPFSTRALVLSILHATLPGIFM    281 - 350
LLLIFFAFLHCWLNAFAEMLRFGDRMFYRDWWNSTSFSNYYRTWNVVVHDWLYSYVYQDGLRLLGARARG    351 - 420
VAMLGVFLVSAVAHEYIFCFVLGFFYPVMLILFLVIGGMLNFMMHDQRTGPAWNVLMWTMLFLGQGIQVS    421 - 490
LYCQEWYARRHCPLPQATFWGLVTPRSWSCHT                                          491 - 522
//

Text Mined References (35)

PMID Year Title