Property Summary

NCBI Gene PubMed Count 33
Grant Count 4
R01 Count 4
Funding $198,485.42
PubMed Score 37.73
PubTator Score 27.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
facioscapulohumeral dystrophy 2.500 0.000

Synonym

Accession O75908 F5H7W4 I6L9H9 Q4VB99 Q4VBA1 Q96TD4 Q9UNR2
Symbols ACAT2
ARGP2
ACACT2

Gene

PANTHER Protein Class (2)

Gene RIF (21)

PMID Text
24478032 TG-interacting factor 1 (Tgif1) is an important repressor of SOAT2 gene expression.
24103759 CDX2, a known positive regulator of hepatocyte differentiation, was regulated by miR-181d and directly activated SOAT2 gene expression.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
17303779 We resequenced 4 candidate genes for HDL regulation and identified several functional nonsynonymous mutations including 4 in lecithin:cholesterol acyltransferase (LCAT), leaving 88% (110/124) of HDL deficient subjects without a genetic diagnosis.
More...

AA Sequence

MEPGGARLRLQRTEGLGGERERQPCGDGNTETHRAPDLVQWTRHMEAVKAQLLEQAQGQLRELLDRAMRE      1 - 70
AIQSYPSQDKPLPPPPPGSLSRTQEPSLGKQKVFIIRKSLLDELMEVQHFRTIYHMFIAGLCVFIISTLA     71 - 140
IDFIDEGRLLLEFDLLIFSFGQLPLALVTWVPMFLSTLLAPYQALRLWARGTWTQATGLGCALLAAHAVV    141 - 210
LCALPVHVAVEHQLPPASRCVLVFEQVRFLMKSYSFLREAVPGTLRARRGEGIQAPSFSSYLYFLFCPTL    211 - 280
IYRETYPRTPYVRWNYVAKNFAQALGCVLYACFILGRLCVPVFANMSREPFSTRALVLSILHATLPGIFM    281 - 350
LLLIFFAFLHCWLNAFAEMLRFGDRMFYRDWWNSTSFSNYYRTWNVVVHDWLYSYVYQDGLRLLGARARG    351 - 420
VAMLGVFLVSAVAHEYIFCFVLGFFYPVMLILFLVIGGMLNFMMHDQRTGPAWNVLMWTMLFLGQGIQVS    421 - 490
LYCQEWYARRHCPLPQATFWGLVTPRSWSCHT                                          491 - 522
//

Text Mined References (35)

PMID Year Title
24478032 2014 TG-interacting factor 1 acts as a transcriptional repressor of sterol O-acyltransferase 2.
24103759 2013 Thyroid hormone negatively regulates CDX2 and SOAT2 mRNA expression via induction of miRNA-181d in hepatic cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
17303779 2007 Genetic etiology of isolated low HDL syndrome: incidence and heterogeneity of efflux defects.
More...