Property Summary

NCBI Gene PubMed Count 41
Grant Count 102
R01 Count 52
Funding $9,188,350.84
PubMed Score 506.00
PubTator Score 154.87

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75907 B2RWQ2 D3DWL6 Q96BB8
Symbols ARAT
DGAT
ARGP1
DIAR7

Gene

PANTHER Protein Class (2)

Gene RIF (25)

PMID Text
25740267 Data indicate no clinically relevant pharmacokinetic interaction between DGAT-1 inhibitor pradigastat and rosuvastatin.
24899196 Downregulation of CLDN1 was associated with altered fatty acid homeostasis in the absence of DGAT1.
24573674 MGAT2 functions as a dimeric or tetrameric protein and selectively heterodimerizes with DGAT1 in mammalian cells
24118885 the apparent lack of therapeutic window owing to GI side effects of AZD7687, particularly diarrhoea, makes the utility of DGAT1 inhibition as a novel treatment for diabetes and obesity questionable.
23420847 Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core
23317570 The structure-activity relationship studies of a novel series of carboxylic acid derivatives of pyridine-carboxamides as DGAT-1 inhibitors is described.
23114594 results identify DGAT1 loss-of-function mutations as a rare cause of congenital diarrheal disorders
22748069 describe distinct but synergistic roles of the two DGATs in an integrated pathway of TAG synthesis and secretion, with DGAT2 acting upstream of DGAT1
21990351 a comprehensive evaluation of a small molecule inhibitor for DGAT1 and suggests that pharmacological inhibition of DGAT1 holds promise in treating diverse metabolic disorders.
21846726 DGAT1 belongs to the family of oligomeric membrane proteins that adopt a dual membrane topology.
More...

AA Sequence

MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVGSGHWELRCHR      1 - 70
LQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAA     71 - 140
NVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFS    141 - 210
YRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLR    211 - 280
RILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVA    281 - 350
ELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS    351 - 420
VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA      421 - 488
//

Text Mined References (42)

PMID Year Title
25740267 2015 Evaluation of a potential transporter-mediated drug interaction between rosuvastatin and pradigastat, a novel DGAT-1 inhibitor.
24899196 2014 Hepatitis C virus entry is impaired by claudin-1 downregulation in diacylglycerol acyltransferase-1-deficient cells.
24573674 2014 Monoacylglycerol acyltransferase-2 is a tetrameric enzyme that selectively heterodimerizes with diacylglycerol acyltransferase-1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24118885 2014 Diacylglycerol acyltransferase 1 inhibition with AZD7687 alters lipid handling and hormone secretion in the gut with intolerable side effects: a randomized clinical trial.
23420847 2013 Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core.
23317570 2013 Lead optimization of a pyridine-carboxamide series as DGAT-1 inhibitors.
23114594 2012 DGAT1 mutation is linked to a congenital diarrheal disorder.
22748069 2012 Diacylglycerol acyltransferase 2 acts upstream of diacylglycerol acyltransferase 1 and utilizes nascent diglycerides and de novo synthesized fatty acids in HepG2 cells.
21990351 2011 Targeting Acyl-CoA:diacylglycerol acyltransferase 1 (DGAT1) with small molecule inhibitors for the treatment of metabolic diseases.
More...