Property Summary

NCBI Gene PubMed Count 5
Grant Count 3
Funding $230,414.2
PubMed Score 4.39
PubTator Score 1.69

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75901 B3KMQ4 Q8N5U8
Symbols PAMCI
PCIP1
P-CIP1

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (1)

PMID Text
25496667 Genome-wide shRNA screening identifies RASSF9, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells

AA Sequence

MAPFGRNLLKTRHKNRSPTKDMDSEEKEIVVWVCQEEKLVCGLTKRTTSADVIQALLEEHEATFGEKRFL      1 - 70
LGKPSDYCIIEKWRGSERVLPPLTRILKLWKAWGDEQPNMQFVLVKADAFLPVPLWRTAEAKLVQNTEKL     71 - 140
WELSPANYMKTLPPDKQKRIVRKTFRKLAKIKQDTVSHDRDNMETLVHLIISQDHTIHQQVKRMKELDLE    141 - 210
IEKCEAKFHLDRVENDGENYVQDAYLMPSFSEVEQNLDLQYEENQTLEDLSESDGIEQLEERLKYYRILI    211 - 280
DKLSAEIEKEVKSVCIDINEDAEGEAASELESSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLL    281 - 350
QMKAKEYELLAKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHS    351 - 420
QDSETTVGDVVLLST                                                           421 - 435
//

Text Mined References (6)

PMID Year Title
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18272789 2008 RASSF7 is a member of a new family of RAS association domain-containing proteins and is required for completing mitosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9837933 1998 P-CIP1, a novel protein that interacts with the cytosolic domain of peptidylglycine alpha-amidating monooxygenase, is associated with endosomes.