Property Summary

NCBI Gene PubMed Count 10
PubMed Score 20.39
PubTator Score 18.02

Knowledge Summary

Patent

No data available

Expression

 GO Process (2)

Gene RIF (1)

AA Sequence

MGRGARVPSEAPGAGVERRWLGAALVALCLLPALVLLARLGAPAVPAWSAAQGDVAALGLSAVPPTRVPG      1 - 70
PLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDL     71 - 140
RIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAA    141 - 210
HEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKR    211 - 280
LCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLA    281 - 350
LGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG                                  351 - 390
//

Text Mined References (10)

PMID Year Title