Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $178,608
PubMed Score 19.96
PubTator Score 18.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession O75900 A2AGN0 A2AGN1 O75894 O75895 Q5QPQ8 Q76P96 Q7LDM6 Q7LDM7 Q9UBR9 Q9UJK8 MMP-23
Symbols MIFR
MMP22
MIFR-1
MMP23A

Gene

 Grant Application (1)

 GO Process (2)

Gene RIF (1)

PMID Text
11328856 Compares rat and human proteins, describes unique Type II membrane topology, and suggests a role in reproductive processes.

AA Sequence

MGRGARVPSEAPGAGVERRWLGAALVALCLLPALVLLARLGAPAVPAWSAAQGDVAALGLSAVPPTRVPG      1 - 70
PLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDL     71 - 140
RIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAA    141 - 210
HEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKR    211 - 280
LCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLA    281 - 350
LGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG                                  351 - 390
//

Text Mined References (10)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15483646 2005 Delineation of mechanisms and regions of dosage imbalance in complex rearrangements of 1p36 leads to a putative gene for regulation of cranial suture closure.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11328856 2001 Cloning and characterization of a rat ortholog of MMP-23 (matrix metalloproteinase-23), a unique type of membrane-anchored matrix metalloproteinase and conditioned switching of its expression during the ovarian follicular development.
10949161 2000 Structural differences of matrix metalloproteinases. Homology modeling and energy minimization of enzyme-substrate complexes.
10419448 1999 Matrix metalloproteinases.
9988691 1999 Cloning and characterization of human MMP-23, a new matrix metalloproteinase predominantly expressed in reproductive tissues and lacking conserved domains in other family members.
9750192 1998 Duplication of a genomic region containing the Cdc2L1-2 and MMP21-22 genes on human chromosome 1p36.3 and their linkage to D1Z2.
9740677 1998 Isolation and characterization of two novel metalloproteinase genes linked to the Cdc2L locus on human chromosome 1p36.3.