Property Summary

NCBI Gene PubMed Count 51
Grant Count 19
R01 Count 13
Funding $1,861,560.45
PubMed Score 83.30
PubTator Score 119.46

Knowledge Summary

Patent (9,588)

Expression

  Differential Expression (16)

Disease log2 FC p
interstitial lung disease 1.700 0.040
oligodendroglioma -2.000 0.000
astrocytoma -1.700 0.000
glioblastoma multiforme -3.000 0.000
ependymoma -2.200 0.000
sonic hedgehog group medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -2.200 0.002
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -2.900 0.003
adrenocortical adenoma -1.765 0.038
interstitial cystitis -2.700 0.006
adult high grade glioma -3.100 0.000
pilocytic astrocytoma -2.000 0.000
subependymal giant cell astrocytoma -2.869 0.030
pituitary cancer 2.100 0.001
psoriasis -2.500 0.000

Gene RIF (31)

PMID Text
25450229 The rare variants in GABBR2 were significantly associated with smoking status.
24923912 Putative GABAA and ASIC1a channels functionally interact with each other, possibly via an inter-molecular association by forming a novel protein complex.
24778228 The endoplasmic reticulum retention signal of GBR1 is not part of the core coiled-coil structure, suggesting that it is sterically shielded by GBR2 upon heterodimer formation.
24682435 GABBR2 receptors are expressed in aortic smooth muscle cells and regulate the [Ca(2+)]i via a Gi/o-coupled receptor pathway and a phospholipase C activation pathway.
24482233 gamma-aminobutyric acidB receptor proteasomal degradation is mediated by the interaction of the GABAB2 C terminus with the proteasomal ATPase Rtp6 and regulated by neuronal activity
22660477 The GABBR2 ectodomain adopts a constitutively open conformation, suggesting a structural asymmetry in the active state of GABA(B) receptor that is unique to the GABAergic system.
22613715 Results show that GABA(B) receptors R1 and R2 must be activated for the modulation of N-type (Ca(v)2.2) calcium channels by analgesic alpha-conotoxins Vc1.1 and RgIA.
22169202 and GABABR2 proteins are reduced in the prefrontal cortex of aged rats but these reductions are not associated with spatial learning abilities.
21971078 The results indicate that there may be specific GABA receptor gene expression variation in migraine, particularly involving the GABRA3 and GABBR2 genes.
21724853 Gamma-aminobutyric acid type B (GABA(B)) receptor internalization is regulated by the R2 subunit.
More...

AA Sequence

MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMGLMPLTKEVAK      1 - 70
GSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTS     71 - 140
IIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSE    141 - 210
VRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWI    211 - 280
IPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVG    281 - 350
PSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG    351 - 420
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTI    421 - 490
LGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFETLCTVRTWIL    491 - 560
TVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSM    561 - 630
EPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVG    631 - 700
IMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKED    701 - 770
SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL    771 - 840
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGV    841 - 910
DASCVSPCVSPTASPRHRHVPPSFRVMVSGL                                           911 - 941
//

Text Mined References (54)

PMID Year Title
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
24923912 2014 Identification of a novel protein complex containing ASIC1a and GABAA receptors and their interregulation.
24778228 2014 Heterodimeric coiled-coil interactions of human GABAB receptor.
24682435 2015 GABAB receptors are expressed in human aortic smooth muscle cells and regulate the intracellular Ca(2+) concentration.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24482233 2014 Proteasomal degradation of ?-aminobutyric acidB receptors is mediated by the interaction of the GABAB2 C terminus with the proteasomal ATPase Rtp6 and regulated by neuronal activity.
24305054 2013 Structural mechanism of ligand activation in human GABA(B) receptor.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
22660477 2012 Structure and functional interaction of the extracellular domain of human GABA(B) receptor GBR2.
22613715 2012 ?-Aminobutyric acid type B (GABAB) receptor expression is needed for inhibition of N-type (Cav2.2) calcium channels by analgesic ?-conotoxins.
More...