Property Summary

NCBI Gene PubMed Count 57
PubMed Score 92.45
PubTator Score 119.46

Knowledge Summary

Patent (9,588)

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical adenoma -1.765 3.8e-02
adult high grade glioma -3.100 7.0e-05
astrocytoma -1.700 1.5e-08
Astrocytoma, Pilocytic -1.900 2.9e-04
atypical teratoid / rhabdoid tumor -2.200 1.8e-03
ependymoma -2.200 4.3e-04
glioblastoma -2.500 3.7e-05
group 3 medulloblastoma -1.900 1.8e-02
interstitial cystitis -2.700 5.7e-03
interstitial lung disease 1.700 4.0e-02
medulloblastoma, large-cell -3.800 2.0e-05
oligodendroglioma -1.100 2.8e-02
pituitary cancer 2.100 1.2e-03
primitive neuroectodermal tumor -2.900 3.2e-03
psoriasis -2.500 1.2e-45
subependymal giant cell astrocytoma -2.721 2.0e-02

Gene RIF (35)

AA Sequence

MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMGLMPLTKEVAK      1 - 70
GSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTS     71 - 140
IIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSE    141 - 210
VRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWI    211 - 280
IPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVG    281 - 350
PSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG    351 - 420
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTI    421 - 490
LGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFETLCTVRTWIL    491 - 560
TVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSM    561 - 630
EPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVG    631 - 700
IMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKED    701 - 770
SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL    771 - 840
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGV    841 - 910
DASCVSPCVSPTASPRHRHVPPSFRVMVSGL                                           911 - 941
//

Text Mined References (62)

PMID Year Title