Property Summary

NCBI Gene PubMed Count 14
PubMed Score 16.15
PubTator Score 13.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.200 3.4e-10
Astrocytoma, Pilocytic 1.500 7.3e-05
ependymoma 2.600 3.4e-12
lung adenocarcinoma -1.700 3.9e-11
lung carcinoma -2.200 2.2e-13
non diabetic and post-ischemic heart fai... 1.100 7.3e-03
non-small cell lung carcinoma -2.100 8.3e-36
oligodendroglioma 1.400 4.9e-02
sonic hedgehog group medulloblastoma 1.600 4.4e-04
type II diabetes mellitus and post-ische... 1.200 1.5e-02

Gene RIF (3)

AA Sequence

MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQN      1 - 70
EGDVEKSKRAPTHQRFPFLEMKIPSLGSGLEQAHAMPSPRILKTHLPFHLLPPSLLEKNCKIIYVARNPK     71 - 140
DNMVSYYHFQRMNKALPAPGTWEEYFETFLAGKVCWGSWHEHVKGWWEAKDKHRILYLFYEDMKKNPKHE    141 - 210
IQKLAEFIGKKLDDKVLDKIVHYTSFDVMKQNPMANYSSIPAEIMDHSISPFMRKGAVGDWKKHFTVAQN    211 - 280
ERFDEDYKKKMTDTRLTFHFQF                                                    281 - 302
//

Text Mined References (16)

PMID Year Title