Property Summary

NCBI Gene PubMed Count 12
Grant Count 2
R01 Count 2
Funding $160,707.8
PubMed Score 14.93
PubTator Score 13.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
26067475 A systematic analysis showed that three of the twelve human SULTs, SULT1A1, SULT1A3 and SULT1C4, displayed the strongest sulphating activity towards acetaminophen.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of sulfotransferase family, cytosolic, 1C, member 4 (SULT1C4) in primary human brain microvascular endothelial cells

AA Sequence

MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQN      1 - 70
EGDVEKSKRAPTHQRFPFLEMKIPSLGSGLEQAHAMPSPRILKTHLPFHLLPPSLLEKNCKIIYVARNPK     71 - 140
DNMVSYYHFQRMNKALPAPGTWEEYFETFLAGKVCWGSWHEHVKGWWEAKDKHRILYLFYEDMKKNPKHE    141 - 210
IQKLAEFIGKKLDDKVLDKIVHYTSFDVMKQNPMANYSSIPAEIMDHSISPFMRKGAVGDWKKHFTVAQN    211 - 280
ERFDEDYKKKMTDTRLTFHFQF                                                    281 - 302
//

Text Mined References (14)

PMID Year Title
26067475 2015 Sulphation of acetaminophen by the human cytosolic sulfotransferases: a systematic analysis.
24028175 2013 Expression of the sulfotransferase 1C family: implications for xenobiotic toxicity.
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
17425406 2007 Structural and chemical profiling of the human cytosolic sulfotransferases.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11535246 2001 Human cytosolic sulphotransferases: genetics, characteristics, toxicological aspects.
11154739 2000 Sulfotransferases in the bioactivation of xenobiotics.
More...