Property Summary

NCBI Gene PubMed Count 22
Grant Count 4
R01 Count 4
Funding $379,557.33
PubMed Score 25.63
PubTator Score 15.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession O75896 B2R4Y9
Symbols PAP
FUS1
PDAP2
C3orf11

Gene

Gene RIF (13)

PMID Text
26367773 FOXP1, TP53INP1, TNFAIP3, and TUSC2 were identified as miR-19a targets.
26053020 The therapeutic activity of TUSC2 could extend the use of erlotinib to lung cancer patients with wildtype EGFR.
24394498 TUSC2P and TUSC2 3'-UTR expression inhibits cell proliferation, survival, migration, invasion and colony formation, and increases tumor cell death. TUSC2P and TUSC2 3'-UTR bind to miRNAs and arrest their functions, leading to increased TUSC2 translation.
24146957 The tumor suppressor gene TUSC2 (FUS1) sensitizes NSCLC to the AKT inhibitor MK2206 in LKB1-dependent manner.
21645495 RNA sequence elements in FUS1 UTRs that regulate FUS1 protein express were identified.
21273575 Absence of tumor suppressor FUS1 protein expression is associated with bone and soft tissue sarcomas.
19852844 The goal of this study was to analyze possible involvement of TUSC2 in malignant pleural mesothelioma.
19671678 These results suggest that the three miRNAs are negative regulators of Fus1 expression in lung cancers.
18172250 FUS1 gene and Fus1 protein abnormalities could be used to develop new strategies for molecular cancer therapy for a significant subset of lung tumors.
18077375 These results suggest that miR-378 enhances cell survival, tumor growth, and angiogenesis through repression of the expression of two tumor suppressors, Sufu and Fus-1.
More...

AA Sequence

MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVT      1 - 70
KNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV                                   71 - 110
//

Text Mined References (24)

PMID Year Title
26367773 2015 Uncovering Direct Targets of MiR-19a Involved in Lung Cancer Progression.
26053020 2015 Exogenous Restoration of TUSC2 Expression Induces Responsiveness to Erlotinib in Wildtype Epidermal Growth Factor Receptor (EGFR) Lung Cancer Cells through Context Specific Pathways Resulting in Enhanced Therapeutic Efficacy.
25416956 2014 A proteome-scale map of the human interactome network.
24394498 2014 The pseudogene TUSC2P promotes TUSC2 function by binding multiple microRNAs.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24146957 2013 The tumor suppressor gene TUSC2 (FUS1) sensitizes NSCLC to the AKT inhibitor MK2206 in LKB1-dependent manner.
21645495 2011 Regulation of tumor suppressor gene FUS1 expression by the untranslated regions of mRNA in human lung cancer cells.
21273575 2011 Frequent absence of tumor suppressor FUS1 protein expression in human bone and soft tissue sarcomas.
19852844 2009 Mechanisms of FUS1/TUSC2 deficiency in mesothelioma and its tumorigenic transcriptional effects.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...