Property Summary

NCBI Gene PubMed Count 161
PubMed Score 21.26
PubTator Score 369.66

Knowledge Summary


No data available


  Disease Sources (2)



Accession O75888 A8MYD5 B4DVT2 Q541E1 Q5U0G8 Q96HV6 Q9P1M8 Q9P1M9
Symbols APRIL




  Ortholog (6)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

 GO Function (1)

Gene RIF (143)

26986150 plasma level elevated in IgA nephropathy
26950089 Abnormal levels of BAFF/APRIL in pediatric acute lymphoblastic leukemia suggest that BAFF/APRIL are associated with the development and progression of this disease in children
26512887 Host-derived proteins pp32 and APRIL interact with a free form of influenza virus RNA-dependent RNA polymerase and preferentially upregulates viral RNA synthesis rather than cRNA synthesis.
26469782 Data show decrease of serum APRIL levels in diabetic patients with Type-1 Diabetes or Type-2 Diabetes suggesting suggest that APRIL can be considered as a potential modulating cytokine in the inflammatory process of diabetes.
26431901 TNFSF13 and FDX1 have potential roles in IgAN in the Han Chinese population. This information may be useful in the development of early prognostics for IgAN.
26370181 Did not find any positive association between TNFSF13 SNPs and the risk of IgA nephropathy after adjustment for age and sex, but did find a significant and strong correlation with relevant clinical pathological parameters.
26296917 high expression of APRIL in clear cell renal cell carcinoma was correlated with high Fuhrman nuclear grade, high pathologic stage, and poor overall and cancer-specific survival of the patients
26268376 SNPs rs9514828 (BAFF), rs3803800 (APRIL) and rs4985726 (TACI) may be associated with the risk of development of B-cell chronic lymphocytic leukemia in a Polish population.
26243624 results indicate that analysis of serum concentrations of BAFF and APRIL potentially represents a useful tool for the assessment of AIHA disease activity and progression.
26150532 the elevated presence of APRIL and BLyS in B cell-rich areas of chronically inflamed gingiva suggests that these cytokines may contribute to bone loss by promoting the survival and persistence of RANKL-expressing B cells/plasma cells.
25759827 elevated serum levels in patients with Behcet's disease
25750171 High APRIL expression is associated with breast cancer.
25729037 Surface APRIL is elevated in circulating myeloid cells in patients with rheumatoid arthritis, where it is highly correlated with disease activity.
25612651 Results show that APRIL was significantly up-regulated in gastric cancer and high levels of APRIL correlated with resistance to cisplatin through the activation of the canonical NF-kappaB pathway.
25582383 Enhanced APRIL levels are associated with acute lymphoblastic leukemia.
25393252 APRIL expression is correlated with malignant gastrointestinal stromal tumours phenotypes and it may serve as an unfavourable prognostic marker in patients with gastrointestinal stromal tumours
25146008 A high APRIL serum level was significantly associated with decreased progression-free survival in follicular lymphoma patients.
24898359 APRIL may participate in the formation of seropositive rheumatoid arthritis.
24748505 APRIL is increased in patients with active systemic lupus erythematosus.
24436270 Our findings indicate TNFSF13 is a prognostic factor in non-small cell lung cancer
24412409 Show a novel method to obtain soluble human APRIL in Escherichia coli using the elastin-like polypeptide and SUMO (ELP-SUMO) tags.
24376672 BAFF and APRIL as well as their cognate receptors (BCMA, TACI) correlate with glioma grade. (Meta-analysis)
24276470 APRIL could be a potential diagnosed marker to distinguish glottic malignant disease from glottic benign lesion, and it may play an important role in the development of glottic malignant disease.
24252051 Our results suggest that an elevated level of BAFF/APRIL drives the maturation of B cells, subsequently leading to IgA2 class switching, and possibly to the development of interstitial lung disease in patients with mixed connective tissue disease.
24141333 Levels of serum APRIL are useful biomarkers for disease progression and disease activity in multiple myeloma.
23887020 The levels of APRIL correlate with the progression of childhood ALL, which may provide certain clues for monitoring ALL clinically.
23867993 APRIL depletion induces cell cycle arrest and apoptosis partly through blocking noncanonical TGF-beta1/ERK.
23846230 Although neither serum BAFF nor APRIL correlated with disease activity in the overall population, elevated serum BAFF and reduced APRIL may be markers of renal and CNS disease in systemic lupus erythematosus patients
23792260 Increased serum expression of APRIL correlates with the development of colorectal neoplasms.
23775715 Using a capture sequencing strategy, we discovered the B-cell relevant genes IRF8, EBF1, and TNFSF13 as novel targets for IGH deregulation.
23768867 High serum APRIL is associated with multiple myeloma.
23383143 APRIL induces tumorigenesis and metastasis of colorectal cancer cells via activation of the PI3K/Akt pathway.
23324534 APRIL protein is upregulated in the serum of patients with opsoclonus-myoclonus syndrome.
23317407 The levels of serum BAFF and APRIL were raised in patients with anti-glomerular basement membrane disease and might be associated with disease activity and kidney damage.
23171638 Data suggest that APRIL protein (a proliferation-inducing ligand) could be a potential biomarker for predicting difficult-to-treat cases of lupus nephritis.
23118916 TNFSF13 may be a susceptibility gene affecting serum IgM levels in Chinese male population.
23088438 Both APRIL and B-cell-activating factor (BAFF) regulate spinal cord injury-induced autoimmunity through B-cell maturation antigen (BMCA).
23071284 the effect of APRIL is mediated via BCMA, which does not activate the classical NF-kappaB pathway, whereas it induces a novel signaling pathway, which involves JNK2 phosphorylation, FOXO3A activation, and GADD45 transcription
23010686 TLR4 expression and the ERK1/2 signaling pathway appear to play only minor roles in APRIL induction in the cells of patients with cancer.
22864923 TNFSF13 could be a susceptible gene which was discovered having relationship with serum IgA level, and smoke might be a factor infecting the IgA level.
22851468 Rituximab has differential effects on BAFF and APRIL levels in primary Sjogren's syndrome patients
22783569 CD256 can be found in antibody-mediated rejection (ABMR) tissues.
22763977 The association between TLR4 activation and APRIL expression in examined leukocytes might have important implications for the immune response of the host exposed to TLR4 ligands such as lipopolysacharides.
22752534 increased serum levels of BLyS and APRIL in BD patients supports the notion of a critical role for B cell activation factors in BD, particularly in terms of uveitis and disease activity.
22719887 found that the BAFF/APRIL system was closely related to the Th1 immune response. Our study delineates previously unreported roles of BAFF and APRIL in the development of tuberculosis
22705846 Both tumor-derived APRIL and APRIL produced by non-tumor cells is supportive in colorectal tumorigenesis.
22593611 These data indicate that BAFF, APRIL, and CD40L form a Chronic lymphocytic leukemia -enhancing bidirectional signaling network linking neoplastic B cells with the microvascular stroma.
22531553 Serum APRIL levels inversely correlate with serum IgG4 levels in patients with IgG4-related disease.
22169295 BAFF and APRIL gene expression in multiple myeloma cells is down-regulated after glucocorticoid and bortezomib treatment.
22102726 BAFF/APRIL inhibition with TACI-Ig induces a significant decrease in the survival of transgenic B cells in the periphery in chimeric mice.
22059379 APRIL and BAFF proteins increase proliferation of human adipose-derived stem cells through activation of Erk1/2 MAP kinase.
21984075 Both alternative splicing and polymorphisms may affect the generation of functional sAPRIL.
21889147 FURIN and its substrate cytokines BAFF and APRIL are over expressed in atherosclerotic plaques.
21765951 The expression of these BAFF, APRIL and TWEAK was analyzed in atopic eczema, seborrheic eczema (SE) and healthy controls (HC).
21733733 Our results suggest increased BAFF and APRIL serum levels in juvenile idiopathic arthritis patients denoting their possible role in the disease.
21724695 High expression of APRIL in systemic lupus erythematosus and rheumatoid arthritis subset may indicate an association between APRIL and lymphoma in these subsets of rheumatic diseases and may reflect a dysregulation of APRIL in these patient groups.
21707303 Data show that the combined analysis of BAFF and APRIL serum levels emerged as an independent predictor of disease progression.
21642598 APRIL production, both in the human and mouse systems, peaks in myeloid precursor cells, before dropping in fully mature granulocytes.
21585290 APRIL levels in cerebrospinal fluid were increased in neuropsychiatric systemic lupus erythematosus as compared with those in other neurological diseases. There was a positive correlation between cerebrospinal fluid APRIL levels and fatigue.
21527528 First evidence for an involvement of APRIL in gastric MALT lymphoma development in Helicobacter pylori-infected patients.
21505913 Data indicate that BAFF and APRIL can induce inflammatory activation of THP-1 cells through the activation of their receptors (TAC1, BAFF-R, and BCMA) and MAPK, which leads to the subsequent activation of NF-kappaB.
21483105 This is the first study, presenting together the TNFSF members APRIL, BAFF, TWEAK and their receptors in different areas of normal renal tissue and renal cell carcinoma.
21293157 There is no difference in serum APRIL among active vasculitis, inactive vasculitis patients and vasculitis patients with infectious complications.
21176341 APRIL protein produced by AML cells probably plays an important role in abnormal proliferation and drug-resistance of AML cells.
20945608 inverse correlation between BAFF and APRIL in Kawasaki disease is reversed by IVIG treatment
20890272 This is the first study, which details local expression of APRIL and BLyS in glomeruli and tubulointerstitium of human proliferative lupus nephritis.
20810514 Production of APRIL is increased in systemic sclerosis peripheral blood mononuclear cells and is associated with the presence of anti-topo I antibodies and more severe disease
20709908 Data show that predominant APRIL-producing cells in the BM microenvironment were not MM cells but were cells of myeloid origin.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20599414 Our preliminary results suggest increased serum APRIL levels in systemic sclerosis patients, particularly in those associated with myositis and hypergammaglobinemia
20518823 membrane form can generate immunomodulatory signals in macrophages
20302641 A novel immunoassay demonstrated that native BLyS/APRIL heterotrimers, as well as BLyS and APRIL homotrimers, are elevated in patients with autoimmune diseases.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20116334 APRIL can serve as a homeostatic down modulator of B-lymphocyte hyperactivity in systemic lupus erythematosus.
20003335 APRIL is a novel chemo-resistance biomarker with independent predictive impact in 5FU-treated colorectal cancer patients
19997650 results suggest that Gln187 may be a crucial amino acid in APRIL-mediated tumor cell proliferation via the MEK-ERK signaling pathway and that the sAPRIL mutants may serve as novel potential antagonists of APRIL for the therapy of APRIL-associated cancers.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19909733 The levels of APRIL, BlyS and receptors as TACI, BCMA and BAFF-R in peripheral blood mononuclear cells of cryptococcal meningitis patients and its clinical significance, was investigated.
19842833 The elevated expression level of APRIL mRNA in sputum of NSCLC suggested that APRIL mRNA may serve as an effective and convenient diagnostic biomarker for NSCLC.
19840904 changes in serum APRIL levels were not significant among primary biliary cirrhosis patients, healthy controls and HCV-infected patients
19828625 APRIL and its receptor B cell maturation antigen (BCMA) are involved in the differentiation process of adipose tissue-derived mesenchymal cells toward becoming adipocyes, with potential applications in the control of adiposity in humans.
19824872 APRIL is over expressed in untreated active immune thrombocytopenia patients and might be a pathogenic factor of this disorder.
19806256 increased plasma levels in patients with coronary artery disease
19788740 Plasma cells (PCs) accumulate in synovial zones rich in secreted APRIL, consistent with a pro-survival role of APRIL for PCs in rheumatoid arthritis
19758161 Results show that IgAD patients had a significant increase of BLyS (P < 0.0001) and APRIL (P = 0.003) levels, and no differences were seen between patients with or without CD.
19741596 we observed APRIL expression, together with TACI and BCMA in gut-associated lymphoid tissue, lamina propria, and in the epithelium of stomach, small and large intestine, and rectum.
19573525 results strongly suggest that APRIL play an important role in the tumor development of the invasive or migratory behavior of CRC cells and may be a useful therapeutic target in the malignant colon carcinomas
19573080 Observational study of gene-disease association. (HuGE Navigator)
19565488 B cells contribute to the enhanced levels of circulating BAFF and APRIL in patients with systemic lupus erythematosus.
19466596 Low levels of APRIL play an essential role in cellular senescence via a heparan sulfate proteoglycan-dependent signaling pathway in a colon carcinoma cell line.
19456850 syndecan-1 is a co-receptor for APRIL and TACI at the cell surface of MMC, promoting the activation of an APRIL/TACI pathway that induces survival and proliferation in multiple myeloma cells
19395025 Patients with a low percentage of leukemic cells with intracellular BAFF or APRIL expression had a significantly longer overall survival than those with a high proportion of APRIL or BAFF positive leukemic cells.
19321861 role for APRIL-TACI-specific signaling in follicular lymphoma B-cell growth
19291294 overexpression and association with tumor progression in many human tumor types - brain, epithelial, lymphoid, germ cells
19175985 Over-expression of BLyS/April may be one of factors contributed to the immunological dysfunction in acute idiopathic thrombocytopenic purpura.
19141538 APRIL alone is sufficient to costimulate B-cell proliferation & drive IgA production & does not require artificial antibody cross-linking.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19037609 The local production of APRIL may be associated with the ectopic lymphoid neogenesis in rheumatoid synovium and may have a role in contributing to the infiltration of plasma cells in synovium within inflamed peripheral joints of RA.
18838478 APRIL acts in an autocrine fashion to protect acute myeloid leukemia cells from drug-induced death
18718031 There are elevated levels of BAFF and APRIL in cerebrospinal fluid of systemic lupus erythematosus (SLE) patients. APRIL was augmented in neuropsychiatric SLE patients compared with SLE patients without central nervous system involvement.
18618015 APRIL secreted by neutrophils binds to heparan sulfate proteoglycans to create plasma cell niches in mucosa.
18423122 APRIL may promote the development of colorectal carcinoma.
18403603 there are potential autocrine and paracrine pathways for BAFF and APRIL signaling in human placentas suggest that lineage-specific regulation of placental cell viability, differentiation and/or other activities may be novel functions of these proteins
18366696 the decreased expression of APRIL in breast cancer, as compared to non-cancer breast structures, suggests a possible negative role of this factor in breast neoplasia progression.
18328673 there was no significant difference of serum APRIL levels in alopecia areata
18204790 Elevated BAFF and APRIL expression levels might partially reflect the common immunological feature of primary antibody deficiency.
18046446 APRIL plays an essential role in the survival of TACI(high) bone marrow-dependent myeloma cells and TACI gene expression may be a useful predictive marker for patients who could benefit from atacicept treatment
17968879 rheumatoid arthritis fibroblast like synoviocytes are stimulated by APRIL and express the APRIL receptor BCMA.
17942754 TACI supported survival of activated B cells and plasmablasts in vitro
17896803 Results suggest that elevated serum APRIL and BAFF levels are differentially associated with disease severity in systemic sclerosis.
17768131 APRIL but not BLyS serum levels are increased in chronic lymphocytic leukemia
17569747 Observational study of gene-disease association. (HuGE Navigator)
17569747 findings show that the APRIL codon G67R polymorphism associated with systemic lupus erythematosus (SLE) in a Japanese population may also be associated with SLE in other populations
17353162 Results suggest that APRIL may play a role in the pathogenesis of brain glioblastoma multiforme.
17307753 Observational study of gene-disease association. (HuGE Navigator)
17190854 APRIL up-regulation was only seen in high-grade B-cell, diffuse large B-cell, & Burkitt lymphomas. APRIL produced by inflammatory cells infiltrating lymphoma lesions may increase tumor aggressiveness and affect disease outcome.
17178712 the signal sequences in APRIL that mediate its intracellular trafficking and provide evidence that this protein ligand of HuR is an important player in the post-transcriptional regulation of CD83 expression
17119122 simultaneous binding of TACI and HSPG on B cells with APRIL is crucial for IgA production
16931039 Review. Direct BAFF/APRIL signalling in T cells and/or T cell modulation in response to a BAFF-modified B cell compartment may play an important role in inflammation and immunomodulation.
16919470 Review. APRIL interactions with BCMA likely govern memory B cell populations.
16916610 Review. The role of APRIL in the pahtogenesis of human B cell disorders is reviewed.
16914324 Review. The splice variants, binding specificities, structural determinants for ligand selectivity, and signaling pathways are reviewed.
16793914 Detailed analysis revealed that APRIL dissociated from producing cells, and secreted APRIL was retained in the tumor lesions.
16239971 APRIL regulates B cell as well as T cell function and has pro- and antiinflammatory activities in rheumatoid arthritis.
16094704 Functional expression of APRIL might contribute to neovascularization via an upregulation of VEGF in HCC.
16087247 APRIL mRNA levels in monocytes and T cells were significantly higher in MS patients than in controls.
15981083 Serum levels of sBAFF and sAPRIL were increased in Sjogren's syndrome, especially in anti-Ro/La+ patients
15860672 conclude that BAFF and APRIL from NLCs can function in a paracrine manner to support leukemia cell survival via mechanisms that are distinct from those of SDF-1alpha
15851487 APRIL binding to the extracellular matrix or to proteoglycan-positive cells induces APRIL oligomerization, which is the prerequisite for the triggering of TACI- and/or BCMA-mediated activation, migration, or survival signals.
15846369 heparan sulfate proteoglycans (HSPG) serve as a receptor for APRIL or that HSPG binding allows APRIL to interact with a receptor that promotes tumor growth
15827134 show that the main site of production for BAFF and APRIL is the bone marrow (BM) environment, and that production is mainly by monocytes and neutrophils. In addition, osteoclasts produce very high levels of APRIL, unlike BM stromal cells
15542592 another form of TACI exists wherein the N-terminal cysteine-rich domain (CRD) is removed by alternative splicing and is capable of ligand-induced cell signaling and that the second CRD alone (TACI_d2) contains full affinity for both APRIL and BAFF
15488762 significantly increased APRIL levels in sera of B cell chronic lymphoid leukemia (B-CLL) patients, indicating that APRIL promotes onset of B-1-associated neoplasms
15105291 APRIL acts as a growth factor for terminal megakaryocytopoiesis and may promote physiologic platelet production.
15070697 serum levels of BAFF and APRIL were increased about 5-fold in patients with multiple myeloma as compared with healthy donors
14978135 Exposure of non-Hodgkin's lymphoma B cells to recombinant or myeloid cell-derived APRIL attenuates apoptosis, increases NF-kappa B activation, up-regulates Bcl-2 and Bcl-xL, and down-regulates Bax.
14691452 production of APRIL and its ability to increase the proliferation of eight human glioblastoma cell lines
14607922 APRIL up-regulates activation-induced cytidine deaminase and enhances class-switch DNA recombination in Epstein-Barr virus-infected B cells.
14504101 B-CLL cells can be rescued from apoptosis through an autocrine process involving BAFF, APRIL, and their receptors.
12730512 Observational study of gene-disease association. (HuGE Navigator)
12370363 When coexpressed with BLYS, APRIL forms active heterotrimeric molecules that circulate in the serum of patients with systemic immune-based rheumatic diseases.
12154359 BLyS and APRIL critically link the innate and adaptive immune responses
12070306 APRIL is involved in the induction and/or maintenance of T and B cell response.

AA Sequence

CYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL                                  211 - 250

Text Mined References (162)

PMID Year Title
26986150 2016 Increased APRIL Expression Induces IgA1 Aberrant Glycosylation in IgA Nephropathy.
26950089 2016 Significance of BAFF/APRIL Expression and Their Receptors in Pediatric Patients With Acute Lymphoblastic Leukemia.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26512887 2015 pp32 and APRIL are host cell-derived regulators of influenza virus RNA synthesis from cRNA.
26469782 2015 Decreased Circulating Levels of APRIL: Questioning Its Role in Diabetes.
26431901 2015 Genetic polymorphisms in TNFSF13 and FDX1 are associated with IgA nephropathy in the Han Chinese population.
26370181 2015 Association between CCDC132, FDX1 and TNFSF13 gene polymorphisms and the risk of IgA nephropathy.
26296917 2015 High expression of APRIL correlates with poor prognosis in clear cell renal cell carcinoma.
26268376 2015 Polymorphisms in genes of the BAFF/APRIL system may constitute risk factors of B-CLL--a preliminary study on a Polish population.
26243624 2015 Serum BAFF and APRIL levels in patients with autoimmune hemolytic anemia and their clinical significance.
26150532 2015 The B Cell-Stimulatory Cytokines BLyS and APRIL Are Elevated in Human Periodontitis and Are Required for B Cell-Dependent Bone Loss in Experimental Murine Periodontitis.
25759827 2014 Expression of TNF-?, APRIL and BCMA in Behcet's disease.
25750171 2015 APRIL promotes breast tumor growth and metastasis and is associated with aggressive basal breast cancer.
25729037 2015 Surface APRIL Is Elevated on Myeloid Cells and Is Associated with Disease Activity in Patients with Rheumatoid Arthritis.
25612651 2015 APRIL induces cisplatin resistance in gastric cancer cells via activation of the NF-?B pathway.
25582383 2015 Prognostic significance of ligands belonging to tumour necrosis factor superfamily in acute lymphoblastic leukaemia.
25393252 2014 High APRIL expression correlates with unfavourable survival of gastrointestinal stromal tumour.
25146008 2015 High APRIL but not BAFF serum levels are associated with poor outcome in patients with follicular lymphoma.
24898359 2014 The role of a proliferation-inducing ligand (APRIL) in the pathogenesis of rheumatoid arthritis.
24748505 2014 Increased serum APRIL differentially correlates with distinct cytokine profiles and disease activity in systemic lupus erythematosus patients.
24436270 2014 High expression of TNFSF13 in tumor cells and fibroblasts is associated with poor prognosis in non-small cell lung cancer.
24412409 2014 Expression and purification of soluble human APRIL in Escherichia coli using ELP-SUMO tag.
24376672 2013 BAFF, APRIL, TWEAK, BCMA, TACI and Fn14 proteins are related to human glioma tumor grade: immunohistochemistry and public microarray data meta-analysis.
24276470 2014 The up-regulation expression of APRIL is a marker of glottic malignant disease.
24252051 2014 Increased serum concentration of BAFF/APRIL and IgA2 subclass in patients with mixed connective tissue disease complicated by interstitial lung disease.
24141333 2014 BAFF and APRIL as TNF superfamily molecules and angiogenesis parallel progression of human multiple myeloma.
23887020 2014 Raised expression of APRIL in Chinese children with acute lymphoblastic leukemia and its clinical implications.
23867993 2013 APRIL depletion induces cell cycle arrest and apoptosis through blocking TGF-?1/ERK signaling pathway in human colorectal cancer cells.
23846230 2013 Association of serum B cell activating factor from the tumour necrosis factor family (BAFF) and a proliferation-inducing ligand (APRIL) with central nervous system and renal disease in systemic lupus erythematosus.
23792260 2013 Serum sAPRIL: a potential tumor-associated biomarker to colorectal cancer.
23775715 2013 A capture-sequencing strategy identifies IRF8, EBF1, and APRIL as novel IGH fusion partners in B-cell lymphoma.
23768867 2013 Evaluation of TNF superfamily molecules in multiple myeloma patients: correlation with biological and clinical features.
23383143 2013 APRIL induces tumorigenesis and metastasis of colorectal cancer cells via activation of the PI3K/Akt pathway.
23324534 2013 BAFF/APRIL system in pediatric OMS: relation to severity, neuroinflammation, and immunotherapy.
23317407 2013 Serum BAFF and APRIL might be associated with disease activity and kidney damage in patients with anti-glomerular basement membrane disease.
23171638 2012 APRIL, a proliferation-inducing ligand, as a potential marker of lupus nephritis.
23118916 2012 Genome-wide scan identifies variant in TNFSF13 associated with serum IgM in a healthy Chinese male population.
23088438 2013 B-cell maturation antigen, a proliferation-inducing ligand, and B-cell activating factor are candidate mediators of spinal cord injury-induced autoimmunity.
23071284 2012 APRIL binding to BCMA activates a JNK2-FOXO3-GADD45 pathway and induces a G2/M cell growth arrest in liver cells.
23010686 A proliferation-inducing ligand (APRIL) in neutrophils of patients with oral cavity squamous cell carcinoma.
22864923 2012 Genome-wide association study identifies TNFSF13 as a susceptibility gene for IgA in a South Chinese population in smokers.
22851468 2013 Serum levels of BAFF, but not APRIL, are increased after rituximab treatment in patients with primary Sjogren's syndrome: data from a placebo-controlled clinical trial.
22783569 2012 CD256 can be found in antibody-mediated renal allograft rejection tissues.
22763977 2012 TLR4 ligation induces expression of APRIL molecule in human neutrophils - a preliminary study.
22752534 2013 Serum level of APRIL/BLyS in Behçet's disease patients: clinical significance in uveitis and disease activity.
22719887 2012 Increased levels of BAFF and APRIL related to human active pulmonary tuberculosis.
22705846 2012 The TNF family member APRIL promotes colorectal tumorigenesis.
22593611 2012 Stromal endothelial cells establish a bidirectional crosstalk with chronic lymphocytic leukemia cells through the TNF-related factors BAFF, APRIL, and CD40L.
22558069 2012 Association of common variants in TNFRSF13B, TNFSF13, and ANXA3 with serum levels of non-albumin protein and immunoglobulin isotypes in Japanese.
22531553 2012 Serum BAFF and APRIL levels in patients with IgG4-related disease and their clinical significance.
22197929 2011 A genome-wide association study in Han Chinese identifies multiple susceptibility loci for IgA nephropathy.
22169295 2011 [Effect of BAFF/APRIL mRNA expression induced by glucocorticoid and bortezomib in multiple myeloma cells in vitro].
22102726 2011 BAFF/APRIL inhibition decreases selection of naive but not antigen-induced autoreactive B cells in murine systemic lupus erythematosus.
22059379 2012 APRIL and BAFF proteins increase proliferation of human adipose-derived stem cells through activation of Erk1/2 MAP kinase.
21984075 2012 Effects of APRIL (TNFSF13) polymorphisms and splicing isoforms on the secretion of soluble APRIL.
21889147 2011 Proprotein convertases in human atherosclerotic plaques: the overexpression of FURIN and its substrate cytokines BAFF and APRIL.
21765951 2011 The expression of BAFF, APRIL and TWEAK is altered in eczema skin but not in the circulation of atopic and seborrheic eczema patients.
21733733 2012 Elevated BAFF (BLyS) and APRIL in Juvenile idiopathic arthritis patients: relation to clinical manifestations and disease activity.
21724695 2011 Expression of APRIL in diffuse large B cell lymphomas from patients with systemic lupus erythematosus and rheumatoid arthritis.
21707303 2011 Combined analysis of levels of serum B-cell activating factor and a proliferation-inducing ligand as predictor of disease progression in patients with chronic lymphocytic leukemia.
21687682 2011 Aberrant expression of functional BAFF-system receptors by malignant B-cell precursors impacts leukemia cell survival.
21642598 2011 Production of the plasma-cell survival factor a proliferation-inducing ligand (APRIL) peaks in myeloid precursor cells from human bone marrow.
21585290 2011 Cerebrospinal fluid levels of a proliferation-inducing ligand (APRIL) are increased in patients with neuropsychiatric systemic lupus erythematosus.
21527528 2011 Tumor-associated macrophages as major source of APRIL in gastric MALT lymphoma.
21505913 2011 BAFF and APRIL induce inflammatory activation of THP-1 cells through interaction with their conventional receptors and activation of MAPK and NF-?B.
21483105 2011 Detection of the TNFSF members BAFF, APRIL, TWEAK and their receptors in normal kidney and renal cell carcinomas.
21293157 2011 Serum levels of BAFF and APRIL in myeloperoxidase anti-neutrophil cytoplasmic autoantibody-associated renal vasculitis: association with disease activity.
21176341 2010 [april mRNA expression in newly diagnosed leukemia patients].
20945608 2010 Altered immunoglobulin A and M levels associated with changes in BAFF and APRIL after administration of intravenous immunoglobulin to treat Kawasaki disease.
20890272 2011 Intrarenal production of B-cell survival factors in human lupus nephritis.
20810514 2010 Increased production of a proliferation-inducing ligand (APRIL) by peripheral blood mononuclear cells is associated with antitopoisomerase I antibody and more severe disease in systemic sclerosis.
20709908 2011 APRIL promotes cell-cycle progression in primary multiple myeloma cells: influence of D-type cyclin group and translocation status.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20599414 2011 Elevated serum levels of a proliferation-inducing ligand in patients with systemic sclerosis: possible association with myositis?
20518823 2010 Macrophages express membrane bound form of APRIL that can generate immunomodulatory signals.
20302641 2010 B-lymphocyte stimulator/a proliferation-inducing ligand heterotrimers are elevated in the sera of patients with autoimmune disease and are neutralized by atacicept and B-cell maturation antigen-immunoglobulin.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20116334 2010 Raised serum level of APRIL in patients with systemic lupus erythematosus: correlations with disease activity indices.
20003335 2009 APRIL is a novel clinical chemo-resistance biomarker in colorectal adenocarcinoma identified by gene expression profiling.
19997650 2009 Two Gln187 mutants of human soluble APRIL inhibit proliferation of lung carcinoma A549 cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19909733 2010 BLyS and APRIL expression in peripheral blood mononuclear cells of cryptococcal meningitis patients and their clinical significance.
19842833 2009 A proliferation-inducing ligand: a new biomarker for non-small cell lung cancer.
19840904 2010 Serum BAFF and APRIL levels in patients with PBC.
19828625 2009 Adipocytes as immune cells: differential expression of TWEAK, BAFF, and APRIL and their receptors (Fn14, BAFF-R, TACI, and BCMA) at different stages of normal and pathological adipose tissue development.
19824872 2009 Raised expression of APRIL in Chinese patients with immune thrombocytopenia and its clinical implications.
19806256 2009 The tumour necrosis factor superfamily ligand APRIL (TNFSF13) is released upon platelet activation and expressed in atherosclerosis.
19788740 2009 Synovial tissues concentrate secreted APRIL.
19758161 2009 B-lymphocyte stimulator and a proliferation-inducing ligand serum levels in IgA-deficient patients with and without celiac disease.
19741596 2009 Gut-associated lymphoid tissue contains the molecular machinery to support T-cell-dependent and T-cell-independent class switch recombination.
19573525 2009 APRIL knockdown suppresses migration and invasion of human colon carcinoma cells.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19565488 2009 Systemic activation of the immune system induces aberrant BAFF and APRIL expression in B cells in patients with systemic lupus erythematosus.
19466596 2009 Reduced APRIL expression induces cellular senescence via a HSPG-dependent pathway.
19456850 2009 APRIL and TACI interact with syndecan-1 on the surface of multiple myeloma cells to form an essential survival loop.
19395025 2009 BAFF and APRIL expression in B-cell chronic lymphocytic leukemia: correlation with biological and clinical features.
19321861 2009 A proliferation-inducing ligand mediates follicular lymphoma B-cell proliferation and cyclin D1 expression through phosphatidylinositol 3-kinase-regulated mammalian target of rapamycin activation.
19291294 2009 APRIL is overexpressed in cancer: link with tumor progression.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19175985 2008 [Expression and significance of BLyS/April in patients with acute idiopathic thrombocytopenic purpura].
19141538 2009 The proteoglycan (heparan sulfate proteoglycan) binding domain of APRIL serves as a platform for ligand multimerization and cross-linking.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19037609 2009 Infiltrations of plasma cells in synovium are highly associated with synovial fluid levels of APRIL in inflamed peripheral joints of rheumatoid arthritis.
18838478 2008 Blocking the APRIL circuit enhances acute myeloid leukemia cell chemosensitivity.
18718031 2008 Raised intrathecal levels of APRIL and BAFF in patients with systemic lupus erythematosus: relationship to neuropsychiatric symptoms.
18618015 2008 APRIL secreted by neutrophils binds to heparan sulfate proteoglycans to create plasma cell niches in human mucosa.
18423122 2008 [Expression of APRIL in colorectal carcinoma tissues and effects of chemotherapeutic agents on APRIL expression in colorectal carcinoma SW480 cells].
18403603 2008 Signaling pathways for B cell-activating factor (BAFF) and a proliferation-inducing ligand (APRIL) in human placenta.
18366696 2008 Expression of TNF-superfamily members BAFF and APRIL in breast cancer: immunohistochemical study in 52 invasive ductal breast carcinomas.
18328673 2008 Serum BAFF and APRIL levels in patients with alopecia areata.
18204790 2008 Age-related changes in BAFF and APRIL profiles and upregulation of BAFF and APRIL expression in patients with primary antibody deficiency.
18046446 2008 Atacicept (TACI-Ig) inhibits growth of TACI(high) primary myeloma cells in SCID-hu mice and in coculture with osteoclasts.
17968879 2007 Rheumatoid arthritis fibroblast-like synoviocytes express BCMA and are stimulated by APRIL.
17942754 2008 TACI, unlike BAFF-R, is solely activated by oligomeric BAFF and APRIL to support survival of activated B cells and plasmablasts.
17896803 2007 Elevated serum APRIL levels in patients with systemic sclerosis: distinct profiles of systemic sclerosis categorized by APRIL and BAFF.
17768131 2007 APRIL but not BLyS serum levels are increased in chronic lymphocytic leukemia: prognostic relevance of APRIL for survival.
17569747 2007 APRIL polymorphism and systemic lupus erythematosus (SLE) susceptibility.
17353162 2006 APRIL is increased in serum of patients with brain glioblastoma multiforme.
17307753 2007 Role of APRIL (TNFSF13) polymorphisms in the susceptibility to systemic lupus erythematosus in Japanese.
17190854 2007 Neutrophil-derived APRIL concentrated in tumor lesions by proteoglycans correlates with human B-cell lymphoma aggressiveness.
17178712 2007 Analysis of nucleocytoplasmic trafficking of the HuR ligand APRIL and its influence on CD83 expression.
17119122 2007 TACI regulates IgA production by APRIL in collaboration with HSPG.
16931039 2006 The role of the BAFF/APRIL system on T cell function.
16919470 2006 BLyS receptor signatures resolve homeostatically independent compartments among naïve and antigen-experienced B cells.
16916610 2006 BAFF, APRIL and human B cell disorders.
16914324 2006 BAFF, APRIL and their receptors: structure, function and signaling.
16793914 2006 The source of APRIL up-regulation in human solid tumor lesions.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16239971 2005 BLyS and APRIL in rheumatoid arthritis.
16094704 2005 Functional expression of a proliferation-related ligand in hepatocellular carcinoma and its implications for neovascularization.
16087247 2005 Increased levels of APRIL (a proliferation-inducing ligand) mRNA in multiple sclerosis.
15981083 2005 Association between circulating levels of the novel TNF family members APRIL and BAFF and lymphoid organization in primary Sjögren's syndrome.
15860672 2005 Nurselike cells express BAFF and APRIL, which can promote survival of chronic lymphocytic leukemia cells via a paracrine pathway distinct from that of SDF-1alpha.
15851487 2005 Identification of proteoglycans as the APRIL-specific binding partners.
15846369 2005 Heparan sulfate proteoglycan binding promotes APRIL-induced tumor cell proliferation.
15827134 2005 The level of TACI gene expression in myeloma cells is associated with a signature of microenvironment dependence versus a plasmablastic signature.
15542592 2005 Structures of APRIL-receptor complexes: like BCMA, TACI employs only a single cysteine-rich domain for high affinity ligand binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488762 2004 APRIL promotes B-1 cell-associated neoplasm.
15105291 2004 Potential role of APRIL as autocrine growth factor for megakaryocytopoiesis.
15070697 2004 BAFF and APRIL protect myeloma cells from apoptosis induced by interleukin 6 deprivation and dexamethasone.
14988498 2004 Impaired IgA class switching in APRIL-deficient mice.
14978135 2004 Lymphoma B cells evade apoptosis through the TNF family members BAFF/BLyS and APRIL.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691452 2004 Abnormal production of the TNF-homologue APRIL increases the proliferation of human malignant glioblastoma cell lines via a specific receptor.
14607922 2003 EBV-encoded latent membrane protein 1 cooperates with BAFF/BLyS and APRIL to induce T cell-independent Ig heavy chain class switching.
14504101 2004 Involvement of BAFF and APRIL in the resistance to apoptosis of B-CLL through an autocrine pathway.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12730512 2003 A novel polymorphism of the human APRIL gene is associated with systemic lupus erythematosus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411489 2002 An endogenous hybrid mRNA encodes TWE-PRIL, a functional cell surface TWEAK-APRIL fusion protein.
12370363 2002 BLyS and APRIL form biologically active heterotrimers that are expressed in patients with systemic immune-based rheumatic diseases.
12154359 2002 DCs induce CD40-independent immunoglobulin class switching through BLyS and APRIL.
12070306 2002 APRIL modulates B and T cell immunity.
11571266 2001 Biologically active APRIL is secreted following intracellular processing in the Golgi apparatus by furin convertase.
10973284 2000 APRIL and TALL-I and receptors BCMA and TACI: system for regulating humoral immunity.
10956646 2000 Tumor necrosis factor (TNF) receptor superfamily member TACI is a high affinity receptor for TNF family members APRIL and BLyS.
10706119 2000 APRIL/TRDL-1, a tumor necrosis factor-like ligand, stimulates cell death.
10662545 2000 Physical map of 17p13 and the genes adjacent to p53.
10331498 1999 TALL-1 is a novel member of the TNF family that is down-regulated by mitogens.
9743536 1998 APRIL, a new ligand of the tumor necrosis factor family, stimulates tumor cell growth.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.