Property Summary

NCBI Gene PubMed Count 174
PubMed Score 22.85
PubTator Score 369.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (156)

AA Sequence

MPASSPFLLAPKGPPGNMGGPVREPALSVALWLSWGAALGAVACAMALLTQQTELQSLRREVSRLQGTGG      1 - 70
PSQNGEGYPWQSLPEQSSDALEAWENGERSRKRRAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQP     71 - 140
ALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNS    141 - 210
CYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL                                  211 - 250
//

Text Mined References (175)

PMID Year Title