Property Summary

NCBI Gene PubMed Count 49
PubMed Score 21.32
PubTator Score 15.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.152 1.4e-02
glioblastoma 1.300 3.8e-05
hepatocellular carcinoma 1.100 2.6e-03
malignant mesothelioma -1.300 9.4e-07
medulloblastoma, large-cell -1.100 6.3e-04
non-small cell lung cancer -1.073 2.1e-17
osteosarcoma 1.205 1.8e-03
ovarian cancer -1.100 7.3e-05
psoriasis -1.200 4.0e-03
tuberculosis and treatment for 3 months -1.200 7.9e-05

Protein-protein Interaction (2)

Gene RIF (12)

AA Sequence

MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPHVALQALTLLG      1 - 70
ACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEFQKDPQFSLISATIKSMKEEG     71 - 140
ITFPPAGSQTVSAAAKNGTSSNKNKEDEDIAKAIELSLQEQKQQHTETKSLYPSSEIQLNNKVARKVRAL    141 - 210
YDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPSNFVTTNLNIETEAAAVDKLNVIDDDVE    211 - 280
EIKKSEPEPVYIDEDKMDRALQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSEL    281 - 350
NVKVLEALELYNKLVNEAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSL    351 - 420
GPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSY    421 - 490
QNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL                                       491 - 525
//

Text Mined References (52)

PMID Year Title