Property Summary

NCBI Gene PubMed Count 46
Grant Count 7
R01 Count 5
Funding $212,205.68
PubMed Score 18.82
PubTator Score 15.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.003
malignant mesothelioma -1.300 0.000
psoriasis -1.200 0.004
osteosarcoma 1.205 0.002
glioblastoma 1.300 0.000
medulloblastoma, large-cell -1.100 0.001
tuberculosis and treatment for 6 months -1.300 0.000
non-small cell lung cancer -1.073 0.000
aldosterone-producing adenoma -1.152 0.014
ovarian cancer -1.100 0.000

Gene RIF (11)

PMID Text
26866605 homologous domain of human Bro1 domain-containing proteins, Alix and Brox, binds CHMP4B but not STAM2, despite their high structural similarity
26601948 The VHS domain of STAM2 directs AMSH to cleave longer Lys63-linked ubiquitin chains
24778033 correlation between the percentage of STAM2-positive cells and mitotic count was statistically significant in Gastrointestinal stromal tumors
22841719 the SH3 domain of STAM2 plays versatile roles in the context of ubiquitin mediated receptor sorting
22493438 report the interactions of the UIM domain and VHS-UIM construct of STAM2 with monoubiquitin (Ub), Lys(48)- and Lys(63)-linked diubiquitins.
22140097 Mice carrying a gene trap insertion in the Stam2 transgene do not reveal phenotype changes; therefore, STAM2 function in the digestive tube remains elusive.
21121635 The study reports the solution NMR structure of the STAM2-VHS domain in complex with monoubiquitin by means of chemical shift perturbations, spin relaxation, and paramagnetic relaxation enhancements.
20504764 PTP1B targets the endosomal sorting machinery; dephosphorylation of regulatory sites on the endosomal sorting complex is required for transport component STAM2
19054391 STAMs function prominently in endoplasmic reticulum-to-Golgi trafficking, most likely through direct interactions with the coat protein II complex
17403676 Rin1 regulates EGFR degradation in cooperation with STAM
More...

AA Sequence

MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPHVALQALTLLG      1 - 70
ACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEFQKDPQFSLISATIKSMKEEG     71 - 140
ITFPPAGSQTVSAAAKNGTSSNKNKEDEDIAKAIELSLQEQKQQHTETKSLYPSSEIQLNNKVARKVRAL    141 - 210
YDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPSNFVTTNLNIETEAAAVDKLNVIDDDVE    211 - 280
EIKKSEPEPVYIDEDKMDRALQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSEL    281 - 350
NVKVLEALELYNKLVNEAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSL    351 - 420
GPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSY    421 - 490
QNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL                                       491 - 525
//

Text Mined References (49)

PMID Year Title
26866605 2016 Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0.
26601948 2016 The Vps27/Hrs/STAM (VHS) Domain of the Signal-transducing Adaptor Molecule (STAM) Directs Associated Molecule with the SH3 Domain of STAM (AMSH) Specificity to Longer Ubiquitin Chains and Dictates the Position of Cleavage.
25416956 2014 A proteome-scale map of the human interactome network.
24778033 2014 Immunohistochemical expression of STAM2 in gastrointestinal stromal tumors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
22841719 2012 Competitive binding of UBPY and ubiquitin to the STAM2 SH3 domain revealed by NMR.
22493438 2012 Evidence for cooperative and domain-specific binding of the signal transducing adaptor molecule 2 (STAM2) to Lys63-linked diubiquitin.
22140097 2012 Neurons and a subset of interstitial cells of Cajal in the enteric nervous system highly express Stam2 gene.
21269460 2011 Initial characterization of the human central proteome.
More...