Property Summary

Ligand Count 1
NCBI Gene PubMed Count 16
PubMed Score 10.09
PubTator Score 17.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma 1.200 3.5e-05
lung cancer 1.800 9.3e-05
medulloblastoma, large-cell 1.100 1.0e-03
oligodendroglioma 1.200 2.1e-02
osteosarcoma 1.595 4.3e-04
pancreatic ductal adenocarcinoma liver m... -1.033 7.0e-03
primitive neuroectodermal tumor 1.100 9.0e-05

Gene RIF (6)

AA Sequence

MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFMETELHCDEKTI      1 - 70
IIGHSSGAIAAMRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPF     71 - 140
LPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA                            141 - 186
//

Text Mined References (20)

PMID Year Title