Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.94
PubTator Score 17.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
oligodendroglioma 1.200 0.021
osteosarcoma 1.595 0.000
medulloblastoma, large-cell 1.100 0.001
primitive neuroectodermal tumor 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.033 0.007
lung cancer 1.800 0.000
group 4 medulloblastoma 1.200 0.000

Synonym

Accession O75884 D3DW31 Q5JPH9 Q9H1D8
Symbols BOG
RBBP10

Gene

PDB

2QS9  

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
1515 screening 445 / 0 / 217672 Primary biochemical high throughput screening assay to identify inhibitors of Retinoblastoma binding protein 9 (RBBP9)
1537 screening 146 / 0 / 262 Confirmation biochemical high throughput screening assay for inhibitors of Retinoblastoma binding protein 9 (RBBP9)
1790 summary 2 / 0 / 3 Summary of probe development efforts to identify inhibitors of Retinoblastoma binding protein 9 (RBBP9).
2248 summary 1 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Retinoblastoma Binding Protein 9 (RBBP9): Gel-based Activity-Based Protein Profiling (ABPP) Gel Filtration Assay
2254 confirmatory 5 / 0 / 2 Late stage results from the probe development effort to identify inhibitors of Retinoblastoma Binding Protein 9 (RBBP9): Gel-based Activity-Based Protein Profiling (ABPP) IC50
2269 screening 13 / 0 / 24 Late stage results from the probe development effort to identify inhibitors of Retinoblastoma Binding Protein 9 (RBBP9): Gel-based Activity-Based Protein Profiling (ABPP) Inhibition
2299 summary 2 / 0 / 0 Summary of probe development efforts to identify inhibitors of Retinoblastoma binding protein 9 (RBBP9): Ester Oxime Scaffold

Gene RIF (6)

PMID Text
22430187 blood samples of lateral sclerosis patients were found to have significantly different levels of expression of CyFIP2 and RbBP9 compared to the levels of expression in control subjects.
21933118 Structure- function studies of RBBP9 suggest possible routes for novel cancer drug discovery programs.
21689726 Data identified RBBP4 and RBBP9 as required for maintenance of multiple PS cell types, and both RBBPs were bound to RB in PS cells.
20080647 identify RBBP9 as a tumor-associated serine hydrolase that displays elevated activity in pancreatic carcinomas. RBBP9 promotes pancreatic carcinogenesis.
19004028 The crystal structure of human RBBP9 has been determined at 1.72 A resolution by the seleno-methionyl single-wavelength anomalous diffraction method.
12296629 RBBP10 was expressed widely in various human tissues, and the expression level is somewhat higher in tumor tissues than in normal tissues.

AA Sequence

MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFMETELHCDEKTI      1 - 70
IIGHSSGAIAAMRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPF     71 - 140
LPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA                            141 - 186
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22430187 2012 Two potential biomarkers identified in mesenchymal stem cells and leukocytes of patients with sporadic amyotrophic lateral sclerosis.
21933118 2012 Human retinoblastoma binding protein 9, a serine hydrolase implicated in pancreatic cancers.
21689726 2011 Retinoblastoma-binding proteins 4 and 9 are important for human pluripotent stem cell maintenance.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20080647 2010 RBBP9: a tumor-associated serine hydrolase activity required for pancreatic neoplasia.
19329999 2009 Identification of selective inhibitors of uncharacterized enzymes by high-throughput screening with fluorescent activity-based probes.
19004028 2009 Crystal structure of human retinoblastoma binding protein 9.
More...