Property Summary

NCBI Gene PubMed Count 34
Grant Count 22
R01 Count 17
Funding $1,241,870.98
PubMed Score 70.70
PubTator Score 36.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.621 0.002

 GO Function (1)

Gene RIF (16)

PMID Text
26351686 Sco1 is a metallochaperone that selectively transfers Cu(I) ions based on loop recognition, whereas Sco2 is a copper-dependent thiol reductase of the cysteine ligands in the oxidase.
26160915 Results find that COA6 associates with COX2 and is crucial for its maturation and complex IV biogenesis. Also, COA6 interacts with the copper chaperone SCO1 which indicates that COA6 is intrinsically involved in the copper delivery process for COX2.
24403053 COX20 cooperates with SCO1 and SCO2 to mature COX2 and promote the assembly of cytochrome c oxidase.
23345593 COX19 is necessary for the transduction of a SCO1-dependent mitochondrial redox signal that regulates ATP7A-mediated cellular copper efflux.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20864674 Results describe the tissue distribution of SCO1 and SCO2 in mouse and human tissues.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19336478 SCO2 acts upstream of SCO1, and that it is indispensable for CO II synthesis.
19295170 a fraction of Sco1 physically associates with the cytochrome c oxidase complex in human muscle mitochondria, suggesting a possible direct relationship between CcO and the regulation of cellular copper homeostasis
More...

AA Sequence

MAMLVLVPGRVMRPLGGQLWRFLPRGLEFWGPAEGTARVLLRQFCARQAEAWRASGRPGYCLGTRPLSTA      1 - 70
RPPPPWSQKGPGDSTRPSKPGPVSWKSLAITFAIGGALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPF     71 - 140
SLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTK    141 - 210
EAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQN    211 - 280
KRKGEIAASIATHMRPYRKKS                                                     281 - 301
//

Text Mined References (37)

PMID Year Title
26351686 2015 Loop recognition and copper-mediated disulfide reduction underpin metal site assembly of CuA in human cytochrome oxidase.
26160915 2015 COA6 is a mitochondrial complex IV assembly factor critical for biogenesis of mtDNA-encoded COX2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25339201 2015 Mutations in COA6 cause cytochrome c oxidase deficiency and neonatal hypertrophic cardiomyopathy.
24403053 2014 Human COX20 cooperates with SCO1 and SCO2 to mature COX2 and promote the assembly of cytochrome c oxidase.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23345593 2013 COX19 mediates the transduction of a mitochondrial redox signal from SCO1 that regulates ATP7A-mediated cellular copper efflux.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20864674 2010 Unexpected vascular enrichment of SCO1 over SCO2 in mammalian tissues: implications for human mitochondrial disease.
More...