Property Summary

NCBI Gene PubMed Count 36
PubMed Score 74.31
PubTator Score 36.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 2.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.621 2.1e-03

 GO Function (1)

Gene RIF (16)

AA Sequence

MAMLVLVPGRVMRPLGGQLWRFLPRGLEFWGPAEGTARVLLRQFCARQAEAWRASGRPGYCLGTRPLSTA      1 - 70
RPPPPWSQKGPGDSTRPSKPGPVSWKSLAITFAIGGALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPF     71 - 140
SLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTK    141 - 210
EAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQN    211 - 280
KRKGEIAASIATHMRPYRKKS                                                     281 - 301
//

Text Mined References (39)

PMID Year Title