Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
R01 Count 6
Funding $824,450.5
PubMed Score 32.20
PubTator Score 4.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 0.013
osteosarcoma -1.241 0.000
glioblastoma -1.700 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.200 0.001
adult high grade glioma -1.500 0.000
pilocytic astrocytoma -1.200 0.000
ovarian cancer 1.300 0.000

Synonym

Accession O75879 Q4W5M8 Q53GP4 Q9P0S6 Q9Y2B8 Glu-AdT subunit B
Symbols PET112
HSPC199
PET112L

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19805282 Studies showed in vitro Gln-tRNA(Gln) formation catalyzed by the recombinant mtGluRS and hGatCAB.

AA Sequence

MAAPMLRWGCRGRRWAFARVDGGSCHRRGAPTGSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLE      1 - 70
IHAQISSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKH     71 - 140
YFYADLPAGYQITQQRLPIAVNGSLIYGVCAGKKQSQVIPKTVRIKQIQLEQDSGKSLHDNLRSQTLIDL    141 - 210
NRAGVGLLEVVLEPDMSCGEEAATAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVK    211 - 280
NLNSIRFLAKAIDYEIQRQINELENGGEILNETRSFHHKLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYD    281 - 350
ATSLPAGADPQQVINIDQIRETLPELPSVTREKLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAEPK    351 - 420
KVTSWVLNTFLGYLKQQNLAVSESPVTPSALAELLDLLDSRTISSSAAKQVFEELWKREGKTPGQIVSEK    421 - 490
QLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLSL       491 - 557
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19805282 2009 Biogenesis of glutaminyl-mt tRNAGln in human mitochondria.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
More...