Property Summary

NCBI Gene PubMed Count 10
PubMed Score 33.79
PubTator Score 4.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.500 2.3e-04
astrocytic glioma -1.200 1.3e-02
Astrocytoma, Pilocytic -1.200 5.5e-05
atypical teratoid / rhabdoid tumor -1.500 5.9e-06
glioblastoma -1.100 1.2e-04
group 4 medulloblastoma -1.400 1.3e-03
medulloblastoma, large-cell -1.700 3.4e-05
osteosarcoma -1.241 2.0e-04
ovarian cancer 1.300 9.3e-11
primitive neuroectodermal tumor -1.200 5.7e-04

Gene RIF (2)

AA Sequence

MAAPMLRWGCRGRRWAFARVDGGSCHRRGAPTGSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLE      1 - 70
IHAQISSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKH     71 - 140
YFYADLPAGYQITQQRLPIAVNGSLIYGVCAGKKQSQVIPKTVRIKQIQLEQDSGKSLHDNLRSQTLIDL    141 - 210
NRAGVGLLEVVLEPDMSCGEEAATAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVK    211 - 280
NLNSIRFLAKAIDYEIQRQINELENGGEILNETRSFHHKLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYD    281 - 350
ATSLPAGADPQQVINIDQIRETLPELPSVTREKLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAEPK    351 - 420
KVTSWVLNTFLGYLKQQNLAVSESPVTPSALAELLDLLDSRTISSSAAKQVFEELWKREGKTPGQIVSEK    421 - 490
QLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLSL       491 - 557
//

Text Mined References (14)

PMID Year Title