Property Summary

NCBI Gene PubMed Count 481
Grant Count 311
R01 Count 107
Funding $51,737,467.62
PubMed Score 1358.09
PubTator Score 1013.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (50)

Expression

Synonym

Accession O75874 Q567U4 Q6FHQ6 Q7Z3V0 Q93090 Q9NTJ9 Q9UKW8 IDH
Symbols IDH
IDP
IDCD
IDPC
PICD
HEL-216
HEL-S-26

Gene

PDB

1T09   1T0L   3INM   3MAP   3MAR   3MAS   4I3K   4I3L   4KZO   4L03   4L04   4L06   4UMX   4UMY   4XRX   4XS3   5DE1   5K10   5K11  

Gene RIF (490)

PMID Text
26951332 treatment with a cell-permeable form of 2-HG sensitized wild-type IDH1 AML cells to ATRA-induced myeloid differentiation, whereas inhibition of 2-HG production significantly reduced ATRA effects in mutant IDH1 cells.
26945349 The IDH1 mutations are associated with improved survival in patients with Glioblastomas.
26936071 Data indicate a significant effect only in one scenario, the interaction between temozolomide (TMZ) and R132H mutations in isocitrate dehydrogenase (IDH1) on the overall survival of lower-grade glioma (LGG)
26927556 Data suggest mutant isocitrate dehydrogenase (IDH1)(R132H) might play a critical role in the cell proliferation and angiogenesis of glioma.
26834160 Our finding suggests that urinary 2-HG is increased among patients with isocitrate dehydrogenases (IDH1 and IDH2) -mutant gliomas, and may represent a future surrogate, noninvasive biomarker to aid in diagnosis, prognosis, and management
26700815 IDH mutations promote gliomagenesis by disrupting chromosomal topology and allowing aberrant regulatory interactions that induce oncogene expression.
26678339 Identify NAD+ depletion as a metabolic susceptibility of IDH1 mutant cancers.
26669865 IDH2 mutation produced more 2-HG than IDH1 mutation in human glioma.
26618343 Genomic alterations in IDH1-mutant glioma malignant progression
26617931 Case Report: right cerebellar pilocytic astrocytoma WHO grade I with an IDH1 R132H mutation.
More...

AA Sequence

MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVG      1 - 70
VKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYR     71 - 140
ATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLS    141 - 210
TKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDS    211 - 280
VAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNK    281 - 350
ELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL          351 - 414
//

Text Mined References (489)

PMID Year Title
26951332 2016 Isocitrate dehydrogenase 1 mutations prime the all-trans retinoic acid myeloid differentiation pathway in acute myeloid leukemia.
26945349 2016 Isocitrate Dehydrogenase (IDH)1/2 Mutations as Prognostic Markers in Patients With Glioblastomas.
26936071 2016 Systematic analysis of overall survival and interactions between tumor mutations and drug treatment.
26927556 2016 [The expression of IDH1 (R132H) is positively correlated with cell proliferation and angiogenesis in glioma samples].
26834160 2016 Elevation of Urinary 2-Hydroxyglutarate in IDH-Mutant Glioma.
26700815 2016 Insulator dysfunction and oncogene activation in IDH mutant gliomas.
26678339 2015 Extreme Vulnerability of IDH1 Mutant Cancers to NAD+ Depletion.
26669865 2016 Noninvasive Quantification of 2-Hydroxyglutarate in Human Gliomas with IDH1 and IDH2 Mutations.
26618343 2016 Integrated genomic characterization of IDH1-mutant glioma malignant progression.
26617931 2015 IDH1 R132H mutation in a pilocytic astrocytoma: a case report.
More...