Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.90
PubTator Score 67.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 0.000

Gene RIF (3)

PMID Text
25567962 CEACAM4 has phagocytic function.
25152032 CEACAM4 is expressed in tumor-derived cell lines, and this expression is specific to an medullary thyroid carcinoma derived cell line.
19460752 Knockdown of carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MGPPSAAPRGGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGKDVLLLACNISETIQAYYWHKG      1 - 70
KTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHV     71 - 140
HQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSRTGRASIQRDLREQPPPASTPGHGPSHRSTFSA    141 - 210
PLPSPRTATPIYEELLYSDANIYCQIDHKADVVS                                        211 - 244
//

Text Mined References (5)

PMID Year Title
25567962 2015 The granulocyte orphan receptor CEACAM4 is able to trigger phagocytosis of bacteria.
25152032 2014 Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) is specifically expressed in medullary thyroid carcinoma cells.
15057824 2004 The DNA sequence and biology of human chromosome 19.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
2050678 1991 Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.