Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.90
PubTator Score 67.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.6e-15
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 3.6e-15

Gene RIF (3)

AA Sequence

MGPPSAAPRGGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGKDVLLLACNISETIQAYYWHKG      1 - 70
KTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHV     71 - 140
HQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSRTGRASIQRDLREQPPPASTPGHGPSHRSTFSA    141 - 210
PLPSPRTATPIYEELLYSDANIYCQIDHKADVVS                                        211 - 244
//

Text Mined References (5)

PMID Year Title