Tbio | AP-1 complex subunit gamma-like 2 |
May function in protein sorting in late endosomes or multivesucular bodies (MVBs). Involved in MVB-assisted maturation of hepatitis B virus (HBV).
Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is compsed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. This protein along with the complex is thought to function at some trafficking step in the complex pathways between the trans-Golgi network and the cell surface. Several alternatively spliced transcript variants of this gene exist, but their full-length nature is not known. [provided by RefSeq, Aug 2013]
Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is compsed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. This protein along with the complex is thought to function at some trafficking step in the complex pathways between the trans-Golgi network and the cell surface. Several alternatively spliced transcript variants of this gene exist, but their full-length nature is not known. [provided by RefSeq, Aug 2013]
Comments
Disease | Target Count |
---|---|
Sudden Cardiac Arrest | 16 |
Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 1.7985690671506E-11 |
ependymoma | 2514 | 2.69277295934548E-8 |
psoriasis | 6685 | 2.87946115813249E-5 |
pilocytic astrocytoma | 3086 | 1.57592772420826E-4 |
pediatric high grade glioma | 2712 | 1.72229449310167E-4 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 2.32268459238653E-4 |
glioblastoma | 5572 | 4.85353918267372E-4 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 5.13067988615276E-4 |
Pick disease | 1893 | 6.03191407807619E-4 |
interstitial cystitis | 2299 | 9.73216313298051E-4 |
medulloblastoma | 1524 | 0.0033874513422409 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 0.00411661197581722 |
atypical teratoid / rhabdoid tumor | 4369 | 0.00412276628744449 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.0046026560258035 |
invasive ductal carcinoma | 2950 | 0.00894754803826049 |
medulloblastoma, large-cell | 6234 | 0.0153199574259571 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Heart disease | 279 | 0.0 | 2.0 |
Disease | log2 FC | p |
---|---|---|
psoriasis | -2.400 | 0.000 |
osteosarcoma | -3.541 | 0.000 |
ependymoma | -1.300 | 0.000 |
atypical teratoid / rhabdoid tumor | -1.200 | 0.004 |
glioblastoma | -1.500 | 0.000 |
medulloblastoma | -1.100 | 0.003 |
medulloblastoma, large-cell | -1.300 | 0.015 |
pancreatic ductal adenocarcinoma liver m... | 1.907 | 0.004 |
intraductal papillary-mucinous adenoma (... | 2.000 | 0.000 |
intraductal papillary-mucinous carcinoma... | 1.800 | 0.001 |
intraductal papillary-mucinous neoplasm ... | 1.800 | 0.005 |
interstitial cystitis | -1.100 | 0.001 |
pediatric high grade glioma | -1.400 | 0.000 |
pilocytic astrocytoma | -1.300 | 0.000 |
Pick disease | -1.400 | 0.001 |
invasive ductal carcinoma | 1.200 | 0.009 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
C. elegans | EggNOG Inparanoid |
Fruitfly | EggNOG Inparanoid |
S.cerevisiae | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
23705972 | Adaptor-related protein complex 1 (AP-1) is necessary for cross-presentation by MHC-I HLA-A and HLA-B molecules containing a cytoplasmic tail tyrosine signal and that HIV-1 Nef inhibits the cross-presentation in antigen-presenting cells |
23678182 | Adaptor-related protein complex 1 (AP-1) is necessary for cross-presentation by MHC-I HLA-A and HLA-B molecules containing a cytoplasmic tail tyrosine signal and that HIV-1 Nef inhibits the cross-presentation in antigen-presenting cells |
23077317 | Adaptor-related protein complex 1 (AP-1) is necessary for cross-presentation by MHC-I HLA-A and HLA-B molecules containing a cytoplasmic tail tyrosine signal and that HIV-1 Nef inhibits the cross-presentation in antigen-presenting cells |
22345475 | Adaptor-related protein complex 1 (AP-1) is necessary for cross-presentation by MHC-I HLA-A and HLA-B molecules containing a cytoplasmic tail tyrosine signal and that HIV-1 Nef inhibits the cross-presentation in antigen-presenting cells |
22103831 | Adaptor-related protein complex 1 (AP-1) is necessary for cross-presentation by MHC-I HLA-A and HLA-B molecules containing a cytoplasmic tail tyrosine signal and that HIV-1 Nef inhibits the cross-presentation in antigen-presenting cells |
21762802 | Adaptor-related protein complex 1 (AP-1) is necessary for cross-presentation by MHC-I HLA-A and HLA-B molecules containing a cytoplasmic tail tyrosine signal and that HIV-1 Nef inhibits the cross-presentation in antigen-presenting cells |
20708039 | Data show that gamma2-adaptin in MVB sorting specifically interacts with the ESCRT subunits Vps28 and CHMP2A. |
20594957 | Adaptor-related protein complex 1 (AP-1) is necessary for cross-presentation by MHC-I HLA-A and HLA-B molecules containing a cytoplasmic tail tyrosine signal and that HIV-1 Nef inhibits the cross-presentation in antigen-presenting cells |
19149577 | Adaptor-related protein complex 1 (AP-1) is necessary for cross-presentation by MHC-I HLA-A and HLA-B molecules containing a cytoplasmic tail tyrosine signal and that HIV-1 Nef inhibits the cross-presentation in antigen-presenting cells |
18854154 | Knockdown of adaptor-related protein complex 1, gamma 2 subunit (AP1G2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1 |
More... |
MVVPSLKLQDLIEEIRGAKTQAQEREVIQKECAHIRASFRDGDPVHRHRQLAKLLYVHMLGYPAHFGQME 1 - 70 CLKLIASSRFTDKRVGYLGAMLLLDERHDAHLLITNSIKNDLSQGIQPVQGLALCTLSTMGSAEMCRDLA 71 - 140 PEVEKLLLQPSPYVRKKAILTAVHMIRKVPELSSVFLPPCAQLLHERHHGILLGTITLITELCERSPAAL 141 - 210 RHFRKVVPQLVHILRTLVTMGYSTEHSISGVSDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTD 211 - 280 TSRNAGNAVLFETVLTIMDIRSAAGLRVLAVNILGRFLLNSDRNIRYVALTSLLRLVQSDHSAVQRHRPT 281 - 350 VVECLRETDASLSRRALELSLALVNSSNVRAMMQELQAFLESCPPDLRADCASGILLAAERFAPTKRWHI 351 - 420 DTILHVLTTAGTHVRDDAVANLTQLIGGAQELHAYSVRRLYNALAEDISQQPLVQVAAWCIGEYGDLLLA 421 - 490 GNCEEIEPLQVDEEEVLALLEKVLQSHMSLPATRGYALTALMKLSTRLCGDNNRIRQVVSIYGSCLDVEL 491 - 560 QQRAVEYDTLFRKYDHMRAAILEKMPLVERDGPQADEEAKESKEAAQLSEAAPVPTEPQASQLLDLLDLL 561 - 630 DGASGDVQHPPHLDPSPGGALVHLLDLPCVPPPPAPIPDLKVFEREGVQLNLSFIRPPENPALLLITITA 631 - 700 TNFSEGDVTHFICQAAVPKSLQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSV 701 - 770 QEIFEVNNLPVESWQ 771 - 785 //
PMID | Year | Title |
---|---|---|
22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. |
21658281 | 2011 | GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease. |
21269460 | 2011 | Initial characterization of the human central proteome. |
20708039 | 2010 | ?2-Adaptin is functioning in the late endosomal sorting pathway and interacts with ESCRT-I and -III subunits. |
18772139 | 2008 | gamma2-Adaptin, a ubiquitin-interacting adaptor, is a substrate to coupled ubiquitination by the ubiquitin ligase Nedd4 and functions in the endosomal pathway. |
18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
17553870 | 2007 | Hepatitis B virus maturation is sensitive to functional inhibition of ESCRT-III, Vps4, and gamma 2-adaptin. |
16867982 | 2006 | Gamma-adaptin, a novel ubiquitin-interacting adaptor, and Nedd4 ubiquitin ligase control hepatitis B virus maturation. |
15231747 | 2004 | A protein interaction framework for human mRNA degradation. |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
More... |