Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.22
PubTator Score 31.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cystic fibrosis -1.012 7.5e-04
head and neck cancer and chronic obstruc... -1.300 2.0e-02
interstitial cystitis -4.400 8.2e-03
intraductal papillary-mucinous neoplasm ... 3.900 5.3e-04
malignant mesothelioma -3.100 1.2e-08
medulloblastoma, large-cell 1.400 1.2e-04
nasopharyngeal carcinoma -3.600 2.1e-09
non-small cell lung cancer 2.529 1.6e-06
ovarian cancer -1.900 3.0e-03
psoriasis -1.100 4.1e-02

Gene RIF (5)

AA Sequence

MAKDNSTVRCFQGLLIFGNVIIGCCGIALTAECIFFVSDQHSLYPLLEATDNDDIYGAAWIGIFVGICLF      1 - 70
CLSVLGIVGIMKSSRKILLAYFILMFIVYAFEVASCITAATQQDFFTPNLFLKQMLERYQNNSPPNNDDQ     71 - 140
WKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVP    141 - 210
GFYHNQGCYELISGPMNRHAWGVAWFGFAILCWTFWVLLGTMFYWSRIEY                        211 - 260
//

Text Mined References (20)

PMID Year Title