Property Summary

NCBI Gene PubMed Count 16
PubMed Score 26.17
PubTator Score 17.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 1.05461487911563E-11
malignant mesothelioma 3163 1.6909515799109E-7
medulloblastoma, large-cell 6234 1.16099820035305E-5
tuberculosis and treatment for 3 months 327 2.47371163362683E-5
pancreatic cancer 2300 8.18185192938704E-5
glioblastoma 5572 1.75018733697305E-4
osteosarcoma 7933 2.48924425132879E-4
chronic lymphosyte leukemia 232 2.76492437246642E-4
atypical teratoid / rhabdoid tumor 4369 5.991326101853E-4
lung cancer 4473 7.10639256804332E-4
medulloblastoma 1524 0.00186733744418258
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0026354699769735
primary pancreatic ductal adenocarcinoma 1271 0.00267689340408436
active ulcerative colitis 477 0.00274958680350858
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00304839701574506
invasive ductal carcinoma 2950 0.00323297971447481
aldosterone-producing adenoma 664 0.00721310537203233
primitive neuroectodermal tumor 3031 0.011804247913662
subependymal giant cell astrocytoma 2287 0.0294612655697178
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 1.0
Disease Target Count Z-score Confidence
Bruxism 19 4.184 2.1

Expression

Synonym

Accession O75840 B2RB03 B7Z4F7 C9JF04 E7EWH1 L0R4P2 Q7Z3H8 Q96E51
Symbols UKLF

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (7)

PMID Text
24207122 a dominant mutation in FBXO38 causes adult-onset, progressive spinal muscular atrophy with calf predominance
19147600 We identified a novel association between the minor A-allele of KLF7 and protection against obesity in the Danish population
19147600 Observational study of gene-disease association. (HuGE Navigator)
16339272 KLF7 may contribute to the pathogenesis of type 2 diabetes through an impairment of insulin biosynthesis and secretion in pancreatic beta-cells and a reduction of insulin sensitivity in peripheral tissues.
15937668 Observational study of gene-disease association. (HuGE Navigator)
15937668 The gene encoding KLF7 is a novel candidate for conferring genetic susceptibility to type 2 diabetes.
14644156 KLF7 was upregulated by morphine at both the transcriptional and the translational levels, promoting cell growth up to day 4

AA Sequence

MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCI      1 - 70
EESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPS     71 - 140
SPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGGLGAEA    141 - 210
CPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFK    211 - 280
CNHCDRCFSRSDHLALHMKRHI                                                    281 - 302
//

Text Mined References (19)

PMID Year Title
24207122 2013 A dominant mutation in FBXO38 causes distal spinal muscular atrophy with calf predominance.
23134681 2013 Shaking the family tree: identification of novel and biologically active alternatively spliced isoforms across the KLF family of transcription factors.
19147600 2009 Variation in the gene encoding Krüppel-like factor 7 influences body fat: studies of 14 818 Danes.
17553693 2007 Ca2+, CREB and krüppel: a novel KLF7-binding element conserved in mouse and human TRKB promoters is required for CREB-dependent transcription.
17351670 2007 A common cis-element in promoters of protein synthesis and cell cycle genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339272 2006 Overexpression of Kruppel-like factor 7 regulates adipocytokine gene expressions in human adipocytes and inhibits glucose-induced insulin secretion in pancreatic beta-cell line.
15937668 2005 Single nucleotide polymorphisms in the gene encoding Krüppel-like factor 7 are associated with type 2 diabetes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15800012 2005 SNPs, microarrays and pooled DNA: identification of four loci associated with mild mental impairment in a sample of 6000 children.
More...