Property Summary

NCBI Gene PubMed Count 17
PubMed Score 32.42
PubTator Score 17.11

Knowledge Summary

Patent

No data available

Expression

Pathway (1)

Gene RIF (8)

AA Sequence

MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCI      1 - 70
EESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPS     71 - 140
SPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGGLGAEA    141 - 210
CPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFK    211 - 280
CNHCDRCFSRSDHLALHMKRHI                                                    281 - 302
//

Text Mined References (20)

PMID Year Title