Property Summary

NCBI Gene PubMed Count 16
Grant Count 8
R01 Count 5
Funding $752,386.23
PubMed Score 26.17
PubTator Score 17.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
24207122 a dominant mutation in FBXO38 causes adult-onset, progressive spinal muscular atrophy with calf predominance
19147600 We identified a novel association between the minor A-allele of KLF7 and protection against obesity in the Danish population
19147600 Observational study of gene-disease association. (HuGE Navigator)
16339272 KLF7 may contribute to the pathogenesis of type 2 diabetes through an impairment of insulin biosynthesis and secretion in pancreatic beta-cells and a reduction of insulin sensitivity in peripheral tissues.
15937668 Observational study of gene-disease association. (HuGE Navigator)
15937668 The gene encoding KLF7 is a novel candidate for conferring genetic susceptibility to type 2 diabetes.
14644156 KLF7 was upregulated by morphine at both the transcriptional and the translational levels, promoting cell growth up to day 4

AA Sequence

MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCI      1 - 70
EESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPS     71 - 140
SPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGGLGAEA    141 - 210
CPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFK    211 - 280
CNHCDRCFSRSDHLALHMKRHI                                                    281 - 302
//

Text Mined References (19)

PMID Year Title
24207122 2013 A dominant mutation in FBXO38 causes distal spinal muscular atrophy with calf predominance.
23134681 2013 Shaking the family tree: identification of novel and biologically active alternatively spliced isoforms across the KLF family of transcription factors.
19147600 2009 Variation in the gene encoding Krüppel-like factor 7 influences body fat: studies of 14 818 Danes.
17553693 2007 Ca2+, CREB and krüppel: a novel KLF7-binding element conserved in mouse and human TRKB promoters is required for CREB-dependent transcription.
17351670 2007 A common cis-element in promoters of protein synthesis and cell cycle genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339272 2006 Overexpression of Kruppel-like factor 7 regulates adipocytokine gene expressions in human adipocytes and inhibits glucose-induced insulin secretion in pancreatic beta-cell line.
15937668 2005 Single nucleotide polymorphisms in the gene encoding Krüppel-like factor 7 are associated with type 2 diabetes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15800012 2005 SNPs, microarrays and pooled DNA: identification of four loci associated with mild mental impairment in a sample of 6000 children.
More...