Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.64
PubTator Score 11.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL RECESSIVE 48 1 0.0 0.0
USHER SYNDROME, TYPE IJ 1 0.0 0.0
Disease Target Count Z-score Confidence
Usher syndrome 32 5.417 2.7
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 4.868 2.4
Disease Target Count Z-score Confidence
Perrault syndrome 19 3.482 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 7.2e-06
facioscapulohumeral dystrophy 1.700 3.7e-02
glioblastoma 1.100 8.5e-04
group 4 medulloblastoma 1.100 1.7e-04
osteosarcoma 1.241 1.2e-04
pituitary cancer 1.100 2.8e-03
primitive neuroectodermal tumor 1.200 4.7e-03

Gene RIF (11)

AA Sequence

MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPF      1 - 70
KERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSEL     71 - 140
DEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI                           141 - 187
//

Text Mined References (23)

PMID Year Title