Property Summary

NCBI Gene PubMed Count 105
PubMed Score 77.70
PubTator Score 96.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.9e-05
ovarian cancer 8520 8.7e-04
psoriasis 6694 1.2e-03
Multiple myeloma 1332 2.3e-03
Breast cancer 3578 2.2e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.628 1.8
Hepatocellular Adenoma 10 3.072 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 3.900 2.2e-02
Multiple myeloma 1.549 2.3e-03
osteosarcoma 2.885 2.9e-05
ovarian cancer -1.300 8.7e-04
psoriasis 1.200 1.2e-03

Synonym

Accession O75832 Q5U0B2 Q8IZK9
Symbols p28
p28(GANK)
dJ889N15.2

Gene

PDB

5VHF   5VHH   5VHI   5VHJ   5VHM   5VHN   5VHO   5VHP   5VHQ   5VHR   1QYM   1TR4   1UOH   4NIK  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (81)

AA Sequence

MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD      1 - 70
DAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEA     71 - 140
TAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQ    141 - 210
VAKGGLGLILKRMVEG                                                          211 - 226
//

Text Mined References (107)

PMID Year Title