Property Summary

NCBI Gene PubMed Count 94
Grant Count 16
R01 Count 16
Funding $1,466,146.78
PubMed Score 69.22
PubTator Score 96.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.549 0.002
psoriasis 1.200 0.001
osteosarcoma 2.885 0.000
Breast cancer 3.900 0.022
ovarian cancer 2.200 0.002

Gene RIF (75)

PMID Text
26554593 Gankyrin-overexpressed non-small cell lung cancer patients had a significantly shorter survival time
26394032 Results identified rs111638916 SNP in the PSMD10 3'-UTR as a risk factor for gastric cancer (GC) and acted as a tumor promoting factor. SNP rs111638916 was also regulated by miR-505, resulting in its up-regulation in patients with GA and AA genotypes.
25842830 On the base results of present study one can suggests the p28GANK being useful as a predictive marker for patient prognosis and a novel therapeutic target for gastric cancer.
25634618 p28GANK expression was increased in metastatic ESCC tissues and cells, and p28GANK knockdown decreased the metastatic ability of ESCC cells.
25294684 IL-1beta stimulation causes sequential phosphorylation of IRAK-1, c-Jun N-terminal kinase, and p300 and enhances recruitment of the p300/CBP/NF-Y complex to Gankyrin promoter
25238053 This study identifies gankyrin, for the first time, as new potential predictive and oncogenic factor of well-differentiated/dedifferentiated liposarcoma, suggesting the potential for service as a future Liposarcoma therapeutic approach.
25131931 MiR-605 directly targets and represses PSMD10 expression.
24999092 Gankyrin is aberrantly expressed beginning at the initiation stage and plays an important role in the initiation, promotion, and progression of hepatocarcinogenesis.
24751719 Gankyrin may be functional in cervical carcinogenesis and metastasis.
24460153 The intensity of gankyrin expression was 'positive' in two cases (20%) and 'strongly positive' in eight cases (80%).
More...

AA Sequence

MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD      1 - 70
DAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEA     71 - 140
TAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQ    141 - 210
VAKGGLGLILKRMVEG                                                          211 - 226
//

Text Mined References (96)

PMID Year Title
26554593 2015 Clinicopathologic features and prognostic implications of Gankyrin protein expression in non-small cell lung cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26394032 2015 Association between functional PSMD10 Rs111638916 variant regulated by MiR-505 and gastric cancer risk in a Chinese population.
25842830 [P28GANK is a novel marker for prognosis and therapeutic target in gastric cancer].
25634618 2015 Overexpression of p28GANK accelerates the metastasis of oesophageal squamous cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25294684 2015 Interleukin-1?/Iinterleukin-1 receptor-associated kinase 1 inflammatory signaling contributes to persistent Gankyrin activation during hepatocarcinogenesis.
25238053 2014 Gankyrin is a predictive and oncogenic factor in well-differentiated and dedifferentiated liposarcoma.
25131931 2014 MiR-605 represses PSMD10/Gankyrin and inhibits intrahepatic cholangiocarcinoma cell progression.
24999092 2014 Gradually elevated expression of Gankyrin during human hepatocarcinogenesis and its clinicopathological significance.
More...