Property Summary

NCBI Gene PubMed Count 17
Grant Count 55
R01 Count 4
Funding $38,696,167
PubMed Score 61.25
PubTator Score 29.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
22110064 The findings indicate that SERPINI2 is a promising candidate for further investigations of the genetic susceptibility to myopia.
20453000 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDTIFLWSLLLLFFGSQASRCSAQKNTEFAVDLYQEVSLSHKDNIIFSPLGITLVLEMVQLGAKGKAQQQ      1 - 70
IRQTLKQQETSAGEEFFVLKSFFSAISEKKQEFTFNLANALYLQEGFTVKEQYLHGNKEFFQSAIKLVDF     71 - 140
QDAKACAEMISTWVERKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTQLINFTKKNGST    141 - 210
VKIPMMKALLRTKYGYFSESSLNYQVLELSYKGDEFSLIIILPAEGMDIEEVEKLITAQQILKWLSEMQE    211 - 280
EEVEISLPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFFEINEDGSEAATST    281 - 350
GIHIPVIMSLAQSQFIANHPFLFIMKHNPTESILFMGRVTNPDTQEIKGRDLDSL                   351 - 405
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22110064 2012 Common polymorphisms in the SERPINI2 gene are associated with refractive error in the 1958 British Birth Cohort.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19641524 2009 Gene knockdown studies revealed CCDC50 as a candidate gene in mantle cell lymphoma and chronic lymphocytic leukemia.
17668148 2007 The role of serpins in the surveillance of the secretory pathway.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...