Property Summary

NCBI Gene PubMed Count 39
PubMed Score 41.48
PubTator Score 46.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 2.044 1.1e-02
active ulcerative colitis 1.571 4.1e-03
cystic fibrosis 1.300 2.1e-03
Endometriosis -1.386 1.9e-02
esophageal adenocarcinoma -1.900 1.8e-02
lung cancer -1.500 1.1e-04
malignant mesothelioma -1.200 9.2e-06
medulloblastoma, large-cell -1.100 4.3e-03
ovarian cancer -1.300 1.2e-03
psoriasis 1.100 6.2e-11

Synonym

Accession O75828 Q6FHP2
Symbols hCBR3
SDR21C2
HEL-S-25

Gene

PDB

2HRB  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (29)

AA Sequence

MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFHQLDIDDLQSI      1 - 70
RALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISS     71 - 140
LQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGWPNSPYGVSKLGVTVLSRILAR    141 - 210
RLDEKRKADRILVNACCPGPVKTDMDGKDSIRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW       211 - 277
//

Text Mined References (40)

PMID Year Title