Property Summary

NCBI Gene PubMed Count 38
Grant Count 13
R01 Count 11
Funding $1,087,995.18
PubMed Score 36.92
PubTator Score 46.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
esophageal adenocarcinoma -1.900 0.018
medulloblastoma, large-cell -1.100 0.004
lung cancer -1.500 0.000
active Crohn's disease 2.044 0.011
ulcerative colitis 2.000 0.000
cystic fibrosis 1.300 0.002
psoriasis 1.100 0.000
Endometriosis -1.386 0.019
ovarian cancer -1.300 0.001

Gene RIF (29)

PMID Text
26799497 association of SNPs in ABCB1 and CBR3 with chronic cardiotoxicity in a cohort of breast cancer patients treated with anthracyclines.
26563179 No significant correlation between cardiotoxicity and SNPs within the CBR pathway. Further investigation into CBR SNPs in a larger adult sample is needed.
23182048 Variants of CBR3 and GSTP1 enzymes may be associated with changes in short-term functional cardiac parameters.
22527884 genetic polymorphism in the CBR3 gene conferred risk of type 2 diabetes and insulin resistance in Chinese. The association was probably mediated through modulation of adipogenesis.
22425771 CBR3 is a novel target gene of inflammatory stimuli; elucidation of its detailed role in inflammation deserves further investigation.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22124095 CBR3 polymorphisms contribute to increased cardiomyopathy risk associated with anthracycline treatment of childhood cancer.
22001310 Computational searches identify a conserved antioxidant response element(ARE) in the distal carbonyl reductase 3 (CBR3) promoter region.
21256830 a physiological role of CBR1, but not for CBR3, in S-nitrosoglutathione reduction and thus ultimately in regulation of NO signaling
20806931 CBR3 is regulated via NRF2-dependent signaling pathways, a finding and plays an important role in the cellular response to oxidative stress.
More...

AA Sequence

MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFHQLDIDDLQSI      1 - 70
RALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISS     71 - 140
LQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGWPNSPYGVSKLGVTVLSRILAR    141 - 210
RLDEKRKADRILVNACCPGPVKTDMDGKDSIRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW       211 - 277
//

Text Mined References (39)

PMID Year Title
26799497 2016 Evidence for association of SNPs in ABCB1 and CBR3, but not RAC2, NCF4, SLC28A3 or TOP2B, with chronic cardiotoxicity in a cohort of breast cancer patients treated with anthracyclines.
26563179 2016 Risk factors for anthracycline-associated cardiotoxicity.
23227193 2012 Analysis of copy number variation in Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
23182048 2012 The relationship between changes in functional cardiac parameters following anthracycline therapy and carbonyl reductase 3 and glutathione S transferase Pi polymorphisms.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22527884 2012 Genetic variation in the carbonyl reductase 3 gene confers risk of type 2 diabetes and insulin resistance: a potential regulator of adipogenesis.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22425771 2012 Expression of human carbonyl reductase 3 (CBR3; SDR21C2) is inducible by pro-inflammatory stimuli.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22124095 2012 Anthracycline-related cardiomyopathy after childhood cancer: role of polymorphisms in carbonyl reductase genes--a report from the Children's Oncology Group.
More...