Property Summary

NCBI Gene PubMed Count 28
PubMed Score 10.32
PubTator Score 23.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 3.300 2.2e-02
hereditary spastic paraplegia -1.012 1.0e-02
Multiple myeloma 1.411 2.9e-03
osteosarcoma -2.635 1.5e-10
ovarian cancer 1.900 6.1e-04
pancreatic cancer -1.100 1.0e-02
primary pancreatic ductal adenocarcinoma -1.031 2.5e-02
tuberculosis and treatment for 3 months -1.100 1.3e-04
Waldenstrons macroglobulinemia 1.281 1.7e-03

Gene RIF (6)

AA Sequence

MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVK      1 - 70
ISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNN     71 - 140
AVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEK    141 - 210
QKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM                          211 - 258
//

Text Mined References (46)

PMID Year Title