Property Summary

NCBI Gene PubMed Count 28
PubMed Score 9.72
PubTator Score 23.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.281 0.002
Multiple myeloma 1.411 0.003
osteosarcoma -2.635 0.000
hereditary spastic paraplegia -1.012 0.010
tuberculosis and treatment for 3 months -1.100 0.000
primary pancreatic ductal adenocarcinoma -1.031 0.025
Breast cancer 3.300 0.022
ovarian cancer 2.400 0.000
pancreatic cancer -1.100 0.010

Synonym

Accession O75822 B4DUI3 F5H425 Q9BUD2 Q9H8Q2 Q9UI65 eIF3j
Symbols EIF3S1
eIF3-p35
eIF3-alpha

Gene

PDB

2KRB   3BPJ  

Gene RIF (6)

PMID Text
25887626 CK2-phosphorylation of eIF3j at Ser127 promotes the assembly of the eIF3 complex, a crucial step in the activation of the translation initiation machinery.
25246524 eIF1, eIF1A, eIF3j, and the eIF2-GTP-Met-tRNAi ternary complex stably bind to the 43 S preinitiation complex
22804784 whether eIF3alpha polymorphism is associated with severe platinum toxicity in patients with non-small cell lung cancer (NSCLC).
22025682 Beta-Arrestin 2 modulates binding of eIF-3-alpha to selected components of the extracellular signal-regulated kinase pathway.
20060839 a conserved tryptophan residue in the human eIF3j N-terminal acidic motif (NTA) is held in the helix alpha1 and loop 5 hydrophobic pocket of the human eIF3b RNA recognition motif (RRM)
17190833 structural analysis of the eIF3b RNA recognition motif and its interaction with eIF3j

AA Sequence

MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVK      1 - 70
ISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNN     71 - 140
AVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEK    141 - 210
QKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM                          211 - 258
//

Text Mined References (45)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25887626 2015 Protein kinase CK2 potentiates translation efficiency by phosphorylating eIF3j at Ser127.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25246524 2014 Human eukaryotic initiation factor 2 (eIF2)-GTP-Met-tRNAi ternary complex and eIF3 stabilize the 43 S preinitiation complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22804784 2013 Association between eIF3? polymorphism and severe toxicity caused by platinum-based chemotherapy in non-small cell lung cancer patients.
More...