Property Summary

NCBI Gene PubMed Count 35
PubMed Score 12.16
PubTator Score 8.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75821 O14801 Q969U5 eIF3g
Symbols EIF3S4
EIF3-P42
eIF3-p44
eIF3-delta

Gene

PDB

2CQ0   2MJC   5K0Y  

Gene RIF (7)

PMID Text
25669430 The disease-associated allele increases EIF3G mRNA expression. EIF3G is located in the narcolepsy risk locus and EIF3G expression correlates with PPAN and P2RY11 expression.
24080033 Important roles for eIF3g in the translation initiation machinery and in DNA degradation during apoptosis.
22493286 down-regulation of eIF3g inhibits the efficiency of nonsense-mediated mRNA decay, which is tightly coupled to CT but not to ET
22190034 HIV-1 Pol is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit G (EIF3G) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20406461 PELO is subcellularly localized at the actin cytoskeleton, interacts with HAX1, EIF3G and SRPX proteins and that this interaction occurs at the cytoskeleton; this interaction may facilitate PELO to detect and degrade aberrant mRNAs.
17094969 AIF overexpression specifically resulted in the activation of caspase-7, thereby amplifying the inhibition of protein
16243297 Furthermore, we found that overexpression of DISC1 in SH-SY5Y cells induces the assembly of eIF3- and TIA-1-positive stress granules (SGs), discrete cytoplasmic granules formed in response to environmental stresses.

AA Sequence

MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVINGNIKTVTEY      1 - 70
KIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQ     71 - 140
EEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKT    141 - 210
GKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSK    211 - 280
GFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN                                  281 - 320
//

Text Mined References (48)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
27373335 2016 eIF3 Peripheral Subunits Rearrangement after mRNA Binding and Start-Codon Recognition.
26935993 2016 Nuclear distribution of eIF3g and its interacting nuclear proteins in breast cancer cells.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25669430 2015 EIF3G is associated with narcolepsy across ethnicities.
25416956 2014 A proteome-scale map of the human interactome network.
24396066 2014 Control of Paip1-eukayrotic translation initiation factor 3 interaction by amino acids through S6 kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24080033 2013 Caspase-mediated cleavage and DNase activity of the translation initiation factor 3, subunit G (eIF3g).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...