Property Summary

NCBI Gene PubMed Count 36
PubMed Score 12.47
PubTator Score 8.94

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (10)

Gene RIF (7)

AA Sequence

MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVINGNIKTVTEY      1 - 70
KIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQ     71 - 140
EEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKT    141 - 210
GKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSK    211 - 280
GFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN                                  281 - 320
//

Text Mined References (49)

PMID Year Title