Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.84
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.300 0.018
oligodendroglioma -1.200 0.033
psoriasis 1.900 0.000
osteosarcoma 1.419 0.005
non-small cell lung cancer 1.422 0.000
lung cancer 1.700 0.000
colon cancer 1.400 0.014
subependymal giant cell astrocytoma 1.143 0.018
mucosa-associated lymphoid tissue lympho... -1.150 0.006
acute myeloid leukemia -1.400 0.045
ovarian cancer 1.800 0.000

Synonym

Accession O75818 Q5VX97 Q8WVK8 RNaseP protein p40
Symbols RNASEP1
bA428J1.3

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
21053045 Data idenified two cleavage sites for RNase MRP/RNase P in the coding sequence of viperin mRNA.
19460752 Knockdown of ribonuclease P/MRP 40kDa subunit (RPP40) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVK      1 - 70
NLPLHELITPEFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETGLQGHPSQFSGRK     71 - 140
IMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVA    141 - 210
LSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCT    211 - 280
ITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYW    281 - 350
LQMAVGANDHCPP                                                             351 - 363
//

Text Mined References (8)

PMID Year Title
21053045 2011 Viperin mRNA is a novel target for the human RNase MRP/RNase P endoribonuclease.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096576 2004 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9630247 1998 Autoantigenic properties of some protein subunits of catalytically active complexes of human ribonuclease P.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.