Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.84
PubTator Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia -1.400 4.5e-02
astrocytic glioma -1.300 1.8e-02
colon cancer 1.400 1.4e-02
lung cancer 1.500 3.9e-03
mucosa-associated lymphoid tissue lympho... -1.150 6.1e-03
non-small cell lung cancer 1.422 1.7e-14
oligodendroglioma -1.200 3.3e-02
osteosarcoma 1.419 5.0e-03
ovarian cancer 1.800 8.7e-05
psoriasis 1.900 2.8e-04
subependymal giant cell astrocytoma 1.143 1.8e-02

 GO Function (1)

Gene RIF (2)

AA Sequence

MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVK      1 - 70
NLPLHELITPEFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETGLQGHPSQFSGRK     71 - 140
IMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVA    141 - 210
LSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCT    211 - 280
ITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYW    281 - 350
LQMAVGANDHCPP                                                             351 - 363
//

Text Mined References (8)

PMID Year Title