Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.33
PubTator Score 8.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 4.18109968407429E-14
ovarian cancer 8492 2.82652592889796E-5
lung cancer 4473 0.0119003377256321
non primary Sjogren syndrome sicca 840 0.017745949799631

Expression

  Differential Expression (4)

Disease log2 FC p
non-small cell lung cancer 1.036 0.000
lung cancer 1.500 0.012
non primary Sjogren syndrome sicca 1.100 0.018
ovarian cancer 1.800 0.000

Synonym

Accession O75817 A4D2E0 Q9BV74 RNaseP protein p20
Symbols RPP2
RPP20
0610037N12Rik

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
20215441 analyses of interactions with deletion mutant proteins indicate that the Alba-type core domain of both Rpp20 and Rpp25 contains most of the determinants for mutual association and P3 RNA recognition.

AA Sequence

MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIY      1 - 70
IHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK     71 - 140
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20215441 2010 Heterodimerization of the human RNase P/MRP subunits Rpp20 and Rpp25 is a prerequisite for interaction with the P3 arm of RNase MRP RNA.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096576 2004 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex.
14715275 2004 Rpp20 interacts with SMN and is re-distributed into SMN granules in response to stress.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...