Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.33
PubTator Score 8.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.500 1.2e-02
non primary Sjogren syndrome sicca 1.100 1.8e-02
non-small cell lung cancer 1.036 4.2e-14
ovarian cancer 1.800 2.8e-05

Gene RIF (1)

AA Sequence

MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIY      1 - 70
IHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK     71 - 140
//

Text Mined References (14)

PMID Year Title