Property Summary

NCBI Gene PubMed Count 36
Grant Count 36
R01 Count 26
Funding $1,330,170.18
PubMed Score 15.28
PubTator Score 18.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
psoriasis -1.800 0.000
Atopic dermatitis -1.200 0.000
tuberculosis -2.900 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.000
colon cancer -1.300 0.013
lung cancer -1.200 0.004
posterior fossa group B ependymoma 1.400 0.000
ulcerative colitis -1.100 0.000
ovarian cancer -1.800 0.000

Gene RIF (16)

PMID Text
25817040 BCAR3 is an essential interactor and mediator of HEF1-induced migration.
25499443 BCAR3 acts as a putative suppressor of breast cancer progression by inhibiting the prometastatic TGFbeta/Smad signaling pathway in invasive breast tumors.
24584939 BCAR1 and BCAR3 scaffolding proteins have roles in cell signaling and antiestrogen resistance
24216110 Taken together, these results demonstrated that BCAR3 plays an important role in the signaling pathways of insulin leading to cell cycle progression and cytoskeleton reorganization, but not GLUT4 translocation.
23762409 BCAR3 promotes cell motility by regulating actin cytoskeletal and adhesion remodeling in invasive breast cancer cells.
22711540 BCAR3 expression may regulate Src signaling in a BCAR3-p130(cas) complex-dependent fashion by altering the ability of the Src SH3 domain to bind the p130(cas) SBD
21262352 BCAR3-p130Cas complex formation is not required for BCAR3-mediated anti-estrogen resistance, Rac activation or discohesion of epithelial breast cancer cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19940159 the c-Src/Cas/BCAR3 signaling axis is a prominent regulator of c-Src activity, which in turn controls cell behaviors that lead to aggressive and invasive breast tumor phenotypes
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAGKFASLPRNMPVNHQFPLASSMDLLSSRSPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHM      1 - 70
GTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKELEE     71 - 140
ELLLSSEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSLSSPGNFVLTCQWKNLAQHFKINRTVLRLSE    141 - 210
AYSRVQYQFEMESFDSIPGLVRCYVGNRRPISQQSGAIIFQPINRTVPLRCLEEHYGTSPGQAREGSLTK    211 - 280
GRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPP    281 - 350
QSSGVDTSPCPNSPVFRTGSEPALSPAVVRRVSSDARAGEALRGSDSQLCPKPPPKPCKVPFLKVPSSPS    351 - 420
AWLNSEANYCELNPAFATGCGRGAKLPSCAQGSHTELLTAKQNEAPGPRNSGVNYLILDDDDRERPWEPA    421 - 490
AAQMEKGQWDKGEFVTPLLETVSSFRPNEFESKFLPPENKPLETAMLKRAKELFTNNDPKVIAQHVLSMD    491 - 560
CRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKI    561 - 630
IQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCV    631 - 700
PPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQP    701 - 770
DEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL                   771 - 825
//

Text Mined References (44)

PMID Year Title
25817040 2015 Human enhancer of filamentation 1-induced colorectal cancer cell migration: Role of serine phosphorylation and interaction with the breast cancer anti-estrogen resistance 3 protein.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25499443 2014 Breast cancer anti-estrogen resistance 3 inhibits transforming growth factor ?/Smad signaling and associates with favorable breast cancer disease outcomes.
25416956 2014 A proteome-scale map of the human interactome network.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24584939 2014 Association of the breast cancer antiestrogen resistance protein 1 (BCAR1) and BCAR3 scaffolding proteins in cell signaling and antiestrogen resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24216110 2013 Functional roles of BCAR3 in the signaling pathways of insulin leading to DNA synthesis, membrane ruffling and GLUT4 translocation.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23762409 2013 Breast cancer antiestrogen resistance 3 (BCAR3) promotes cell motility by regulating actin cytoskeletal and adhesion remodeling in invasive breast cancer cells.
More...