Property Summary

NCBI Gene PubMed Count 36
PubMed Score 16.56
PubTator Score 18.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Substance-Related Disorders 115 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Breast cancer 3577 3.495 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -1.200 5.5e-05
colon cancer -1.300 1.3e-02
intraductal papillary-mucinous adenoma (... 1.400 2.9e-04
lung cancer -1.200 4.2e-03
malignant mesothelioma -1.700 1.6e-07
ovarian cancer -1.800 5.6e-05
posterior fossa group B ependymoma 1.400 6.3e-08
psoriasis -1.300 1.3e-11
tuberculosis -2.900 6.4e-09
ulcerative colitis -1.100 2.7e-04

Gene RIF (16)

AA Sequence

MAAGKFASLPRNMPVNHQFPLASSMDLLSSRSPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHM      1 - 70
GTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKELEE     71 - 140
ELLLSSEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSLSSPGNFVLTCQWKNLAQHFKINRTVLRLSE    141 - 210
AYSRVQYQFEMESFDSIPGLVRCYVGNRRPISQQSGAIIFQPINRTVPLRCLEEHYGTSPGQAREGSLTK    211 - 280
GRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPP    281 - 350
QSSGVDTSPCPNSPVFRTGSEPALSPAVVRRVSSDARAGEALRGSDSQLCPKPPPKPCKVPFLKVPSSPS    351 - 420
AWLNSEANYCELNPAFATGCGRGAKLPSCAQGSHTELLTAKQNEAPGPRNSGVNYLILDDDDRERPWEPA    421 - 490
AAQMEKGQWDKGEFVTPLLETVSSFRPNEFESKFLPPENKPLETAMLKRAKELFTNNDPKVIAQHVLSMD    491 - 560
CRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKI    561 - 630
IQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCV    631 - 700
PPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQP    701 - 770
DEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL                   771 - 825
//

Text Mined References (44)

PMID Year Title