Property Summary

NCBI Gene PubMed Count 48
Grant Count 46
R01 Count 35
Funding $4,430,945.14
PubMed Score 127.88
PubTator Score 81.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.494 0.006
tuberculosis and treatment for 3 months -1.300 0.000
non-small cell lung cancer -2.019 0.000
lung cancer -1.800 0.000
active Crohn's disease -1.451 0.023
diabetes mellitus -1.200 0.014
lung adenocarcinoma -1.400 0.000
aldosterone-producing adenoma -1.103 0.022
invasive ductal carcinoma -1.114 0.047
psoriasis -1.300 0.000
COPD -1.100 0.024
lung carcinoma -2.100 0.000
gastric carcinoma 1.400 0.010
Bipolar Disorder 1.388 0.040
acute myeloid leukemia 2.500 0.002
pituitary cancer -1.500 0.001
pancreatic cancer 1.200 0.027

Gene RIF (28)

PMID Text
26743901 The results suggest that dephosphorylation of eIF2a by GADD34 plays an important role in doxorubicin resistance of MCF-7/ADR cells.
26742780 The reactive oxygen species-generating NADPH oxidase-4 (Nox4) is induced downstream of ATF4, binds to a PP1-targeting subunit GADD34 at the endoplasmic reticulum, and inhibits PP1 activity to increase eIF2alpha phosphorylation and ATF4 levels.
26142647 GADD34 was increased in neurons of human Alzheimer's disease (AD) brains. Additionally, this finding was also observed in oligodendrocytes in human AD brains. GADD34 could be a therapeutic target for preventing ER stress in neuronal cells in AD.
26100893 Data indicate that protein phosphatase 1 subunit GADD34 directly interacts with eukaryotic translation initiation factor 2 subunit alpha (eIF2alpha).
26095357 The data highlight independent interactions of PP1 and eIF2alpha with GADD34, demonstrating that GADD34 functions as a scaffold both in vitro and in cells
26083346 stress pathways lead to the induction of the protein GADD34, which appears to provide protection against the toxic effects of the secreted virulence factors in Pseudomonas aeruginosa infection
26041779 GADD34 promotes cell survival and adaptation to increased extracellular osmolarity by increasing the uptake of small neutral amino acids via the amino acid transporter SNAT2.
25659802 GADD34 enhances autophagy and suppresses apoptosis stimulated by LPS combined with amino acid deprivation through regulation of mTOR signaling pathway in macrophages.
25204313 GADD34 may play a neuroprotective role against amyloid-beta toxicity.
24092754 GADD34 phosphorylation on tyrosine 262 modulates endoplasmic reticulum stress signaling and cell fate.
More...

AA Sequence

MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAVKGAALVEAGLEGEARTPLAI      1 - 70
PHTPWGRRPEEEAEDSGGPGEDRETLGLKTSSSLPEAWGLLDDDDGMYGEREATSVPRGQGSQFADGQRA     71 - 140
PLSPSLLIRTLQGSDKNPGEEKAEEEGVAEEEGVNKFSYPPSHRECCPAVEEEDDEEAVKKEAHRTSTSA    141 - 210
LSPGSKPSTWVSCPGEEENQATEDKRTERSKGARKTSVSPRSSGSDPRSWEYRSGEASEEKEEKAHKETG    211 - 280
KGEAAPGPQSSAPAQRPQLKSWWCQPSDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDT    281 - 350
EEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSA    351 - 420
STPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKET    421 - 490
EEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSE    491 - 560
KVTVHFLAVWAGPAQAARQGPWEQLARDRSRFARRITQAQEELSPCLTPAARARAWARLRNPPLAPIPAL    561 - 630
TQTLPSSSVPSSPVQTTPLSQAVATPSRSSAAAAAALDLSGRRG                              631 - 674
//

Text Mined References (53)

PMID Year Title
26743901 2016 Salubrinal-Mediated Upregulation of eIF2? Phosphorylation Increases Doxorubicin Sensitivity in MCF-7/ADR Cells.
26742780 2016 Targeted redox inhibition of protein phosphatase 1 by Nox4 regulates eIF2?-mediated stress signaling.
26142647 2015 Increased GADD34 in oligodendrocytes in Alzheimer's disease.
26100893 2015 An eIF2?-binding motif in protein phosphatase 1 subunit GADD34 and its viral orthologs is required to promote dephosphorylation of eIF2?.
26095357 2015 Structural and Functional Analysis of the GADD34:PP1 eIF2? Phosphatase.
26083346 2015 Virulence Factors of Pseudomonas aeruginosa Induce Both the Unfolded Protein and Integrated Stress Responses in Airway Epithelial Cells.
26041779 2015 Coordinated Regulation of the Neutral Amino Acid Transporter SNAT2 and the Protein Phosphatase Subunit GADD34 Promotes Adaptation to Increased Extracellular Osmolarity.
25659802 2015 GADD34 inhibits activation-induced apoptosis of macrophages through enhancement of autophagy.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25204313 2015 Induction of GADD34 Regulates the Neurotoxicity of Amyloid ?.
More...