Property Summary

NCBI Gene PubMed Count 73
Grant Count 22
R01 Count 9
Funding $2,652,747.87
PubMed Score 88.39
PubTator Score 118.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (77)

PMID Text
26882814 UGT2B17 deletion polymorphisms are associated with the risk of developing pancreatic cancer in Chinese Han population, especially in the female population.
26407805 UGT2B17 contributes to the in-vitro glucuronidation of arctigenin in liver/intestinal microsomes.
26385605 miR-376c is inversely linked to UGT2B15 and UGT2B17 expression in high-grade prostate cancer and metastasis.UGT2B15 and UGT2B17 genes are direct targets of miR-376c and thus may influence steroid metabolism during prostate cancer progression.
26367234 UGT2B17 mismatch has a negative clinical impact in allogeneic HSCT from HLA-identical sibling donors only when a male donor is used.
26198073 GC-C-IRMS analysis sensitive to testosterone doping independent of UGT2B17 genotype.
26176234 This descriptive study examines correlations between concentrations of tamoxifen's glucuronide metabolites and genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 in 132 patients with estrogen receptor-positive breast cancer under treatment with tamoxifen.
26163549 Expression of UGT2B15 and UGT2B17 is negatively regulated by the binding of miR-376c.
25886176 UGT2B17-deletion interacting with p16 (+) may modify effects of smoking on TP53-mutations and may further interact with the disruptive TP53-mutations to raise relapse rates among Japanese patients with head and neck squamous cell carcinomas.
25794161 These data suggest that UGT2B17 deletion leads to reduced UGT2B17 activity, and lower BMI in male individuals. This is consistent with the hypothesis that reduced UGT2B17-mediated testosterone excretion results in higher testosterone levels
24802609 The UGT2B17 deletion polymorphism is not associated with tumor risks.
More...

AA Sequence

MSLKWMSVFLLMQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSS      1 - 70
AIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRK     71 - 140
LQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFME    141 - 210
RIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGG    211 - 280
LHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGS    281 - 350
NTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT    351 - 420
MSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYH    421 - 490
SLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD                                  491 - 530
//

Text Mined References (74)

PMID Year Title
26882814 2015 Association of Genetic Polymorphisms in UDP-Glucuronosyltransferases 2B17 with the Risk of Pancreatic Cancer in Chinese Han Population.
26407805 2015 Identification and characterization of human UDP-glucuronosyltransferases responsible for the in-vitro glucuronidation of arctigenin.
26385605 2016 Epigenetic regulation of steroid inactivating UDP-glucuronosyltransferases by microRNAs in prostate cancer.
26367234 2016 UGT2B17 minor histocompatibility mismatch and clinical outcome after HLA-identical sibling donor stem cell transplantation.
26198073 Dose-dependent testosterone sensitivity of the steroidal passport and GC-C-IRMS analysis in relation to the UGT2B17 deletion polymorphism.
26176234 2015 Impacts of the Glucuronidase Genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 on Tamoxifen Metabolism in Breast Cancer Patients.
26163549 2015 Regulation of Human UGT2B15 and UGT2B17 by miR-376c in Prostate Cancer Cell Lines.
25886176 2015 Homozygous deletions of UGT2B17 modifies effects of smoking on TP53-mutations and relapse of head and neck carcinoma.
25794161 2015 Genetic and phenotypic variation in UGT2B17, a testosterone-metabolizing enzyme, is associated with BMI in males.
24802609 2014 Meta-analysis reveals a lack of association between UGT2B17 deletion polymorphism and tumor susceptibility.
More...