Property Summary

NCBI Gene PubMed Count 45
PubMed Score 14.46
PubTator Score 44.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 8.9e-04
Multiple myeloma 1332 2.2e-03
lung cancer 4740 2.1e-02
Breast cancer 3578 2.8e-02
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.346 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.500 2.8e-02
lung cancer 1.500 2.1e-02
Multiple myeloma 1.150 2.2e-03
ovarian cancer 1.700 8.9e-04

Synonym

Accession O75794 A8JZZ7 Q14107 Q5T0L4 Q5T0L5 Q5T0L7 Q5T0L8 Q5T0L9 Protein D123
Symbols D123
C10orf7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (5)

Gene RIF (30)

AA Sequence

MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDSDDEAEEIQWS      1 - 70
DDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFKSSDFI     71 - 140
TRDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIR    141 - 210
RCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQ    211 - 280
EQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD                  281 - 336
//

Text Mined References (47)

PMID Year Title