Property Summary

NCBI Gene PubMed Count 45
PubMed Score 14.20
PubTator Score 44.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Pulmonary function (finding) 33
Disease Target Count P-value
ovarian cancer 8492 8.87046811571247E-4
Multiple myeloma 1328 0.00218000116010824
lung cancer 4473 0.0213840341867969
Breast cancer 3099 0.0280468531488129
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.322 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.150 0.002
lung cancer 1.500 0.021
Breast cancer 2.500 0.028
ovarian cancer 1.700 0.001

Synonym

Accession O75794 A8JZZ7 Q14107 Q5T0L4 Q5T0L5 Q5T0L7 Q5T0L8 Q5T0L9 Protein D123
Symbols D123
C10orf7

Gene

  Ortholog (15)

Pathway (1)

Gene RIF (30)

PMID Text
25976611 CDC123 may have a role in novel protein modifications
22923468 Association to type 2 diabetes was found for rs13266634 (SLC30A8), rs7923837 (HHEX), rs10811661 (CDKN2A/2B), rs4402960 (IGF2BP2), rs12779790 (CDC123/CAMK1D), and rs2237892 (KCNQ1).
21909839 A significant association of rs10906115 in CDC123/CAMK1D and rs1359790 near SPRY2 was identified with type 2 diabetes in a Japanese population.
20927120 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDSDDEAEEIQWS      1 - 70
DDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFKSSDFI     71 - 140
TRDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIR    141 - 210
RCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQ    211 - 280
EQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD                  281 - 336
//

Text Mined References (47)

PMID Year Title
25976611 2015 The eukaryotic translation initiation regulator CDC123 defines a divergent clade of ATP-grasp enzymes with a predicted role in novel protein modifications.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
22961080 2013 A genome-wide association study identifies GRK5 and RASGRP1 as type 2 diabetes loci in Chinese Hans.
22923468 2012 Contribution of common genetic variation to the risk of type 2 diabetes in the Mexican Mestizo population.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21909839 2011 Genetic variants at CDC123/CAMK1D and SPRY2 are associated with susceptibility to type 2 diabetes in the Japanese population.
21269460 2011 Initial characterization of the human central proteome.
20927120 2010 Variations in/nearby genes coding for JAZF1, TSPAN8/LGR5 and HHEX-IDE and risk of type 2 diabetes in Han Chinese.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
More...