Property Summary

NCBI Gene PubMed Count 19
PubMed Score 146.70
PubTator Score 11.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
AICARDI-GOUTIERES SYNDROME 4 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Aicardi-Goutieres syndrome 19

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia -1.200 1.7e-02
adrenocortical carcinoma 1.705 6.1e-07
adult high grade glioma 1.600 7.7e-05
atypical teratoid / rhabdoid tumor 2.200 3.7e-09
Breast cancer 1.600 2.9e-14
colon cancer 1.600 2.1e-03
Endometriosis 1.008 3.4e-02
ependymoma 1.100 1.3e-06
glioblastoma 1.900 9.0e-11
group 3 medulloblastoma 2.800 3.1e-07
invasive ductal carcinoma 1.600 3.3e-04
lung adenocarcinoma 1.100 8.2e-10
lung cancer 2.300 1.7e-04
medulloblastoma, large-cell 3.000 2.2e-07
non-small cell lung cancer 1.873 2.9e-21
osteosarcoma -2.034 2.7e-04
ovarian cancer 1.300 1.5e-03
primitive neuroectodermal tumor 2.400 5.0e-06
psoriasis 1.100 3.4e-13

Gene RIF (6)

AA Sequence

MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKT      1 - 70
LLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFV     71 - 140
DTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGY    141 - 210
PNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQAR    211 - 280
PRSSHRYFLERGLESATSL                                                       281 - 299
//

Text Mined References (23)

PMID Year Title