Property Summary

NCBI Gene PubMed Count 17
PubMed Score 142.98
PubTator Score 11.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.87422405421053E-21
Breast cancer 3099 2.85090972820703E-14
psoriasis 6685 3.36317924269183E-13
lung adenocarcinoma 2714 8.21413043346144E-10
atypical teratoid / rhabdoid tumor 4369 3.7395777114835E-9
pediatric high grade glioma 2712 9.21851993883325E-8
medulloblastoma, large-cell 6234 2.22069759701077E-7
group 3 medulloblastoma 2254 3.13370031979966E-7
adrenocortical carcinoma 1427 6.12734399769276E-7
posterior fossa group A ependymoma 1511 2.33806830219163E-6
glioblastoma 5572 3.08554776263168E-6
primitive neuroectodermal tumor 3031 4.96359638801831E-6
lung cancer 4473 1.73602189401068E-4
osteosarcoma 7933 2.66387623278906E-4
invasive ductal carcinoma 2950 3.26473091272379E-4
ovarian cancer 8492 0.00152661317321597
colon cancer 1475 0.00207390345382046
acute myeloid leukemia 785 0.0168365269540544
Endometriosis 535 0.0341879534933501

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -2.034 0.000
posterior fossa group A ependymoma 1.300 0.000
glioblastoma 2.100 0.000
group 3 medulloblastoma 2.800 0.000
atypical teratoid / rhabdoid tumor 2.200 0.000
medulloblastoma, large-cell 3.000 0.000
primitive neuroectodermal tumor 2.400 0.000
adrenocortical carcinoma 1.705 0.000
non-small cell lung cancer 1.873 0.000
colon cancer 1.600 0.002
lung cancer 2.300 0.000
pediatric high grade glioma 1.900 0.000
lung adenocarcinoma 1.100 0.000
psoriasis 1.100 0.000
Endometriosis 1.008 0.034
Breast cancer 1.600 0.000
invasive ductal carcinoma 1.600 0.000
acute myeloid leukemia -1.200 0.017
ovarian cancer 1.300 0.002

Synonym

Accession O75792 B2RCY1 Q96F11 RNase H2 subunit A
Symbols AGS4
JUNB
RNHL
RNHIA
RNASEHI

Gene

PDB

3P56   3PUF  

  Ortholog (16)

Gene RIF (4)

PMID Text
25703292 Studies indicate that most antiviral-defense systems involve RNase H-like enzymes destroying invading nucleic acids, RNA, or DNA.
24986920 RNase H2 complex is assembled in the cytosol and imported into the nucleus in an RNase H2B-dependent manner.
23592335 study identified two synonymous variants in RNASEH2A that result in loss of RNase H2 enzyme function and the consequent Aicardi-Goutieres syndrome phenotype
21454563 analysis of the RNase H2A subunit mutations that cause Aicardi-Goutieres syndrome

AA Sequence

MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKT      1 - 70
LLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFV     71 - 140
DTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGY    141 - 210
PNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQAR    211 - 280
PRSSHRYFLERGLESATSL                                                       281 - 299
//

Text Mined References (21)

PMID Year Title
25703292 2015 The reverse transcriptase-RNase H: from viruses to antiviral defense.
24986920 2014 Altered spatio-temporal dynamics of RNase H2 complex assembly at replication and repair sites in Aicardi-Goutières syndrome.
23603115 2013 Ribonucleotides misincorporated into DNA act as strand-discrimination signals in eukaryotic mismatch repair.
23592335 2013 Synonymous mutations in RNASEH2A create cryptic splice sites impairing RNase H2 enzyme function in Aicardi-Goutières syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21454563 2011 Functional consequences of the RNase H2A subunit mutations that cause Aicardi-Goutieres syndrome.
21269460 2011 Initial characterization of the human central proteome.
21177858 2011 The structural and biochemical characterization of human RNase H2 complex reveals the molecular basis for substrate recognition and Aicardi-Goutières syndrome defects.
More...