Property Summary

NCBI Gene PubMed Count 61
PubMed Score 487.58
PubTator Score 250.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 1.3e-18
pancreatic cancer 2398 3.4e-03
pancreatic carcinoma 562 3.4e-03
osteosarcoma 7950 8.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
lung carcinoma -1.300 1.3e-18
osteosarcoma -1.199 8.2e-03
pancreatic cancer 1.100 3.4e-03
pancreatic carcinoma 1.100 3.4e-03

Gene RIF (19)

AA Sequence

MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAEN      1 - 70
LLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQ     71 - 140
KQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPA    141 - 210
PQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALY    211 - 280
DFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR                        281 - 330
//

Text Mined References (67)

PMID Year Title