Property Summary

NCBI Gene PubMed Count 58
Grant Count 100
R01 Count 39
Funding $34,472,236.51
PubMed Score 465.26
PubTator Score 250.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic cancer 1.100 0.003
osteosarcoma -1.199 0.008
pancreatic carcinoma 1.100 0.003
lung carcinoma -1.300 0.000

Synonym

Accession O75791 B7Z8I3 O43726 Q9NRB7
Symbols P38
GADS
GRID
GRPL
GrbX
Mona
GRB2L
GRBLG
Grf40
GRAP-2

Gene

Gene RIF (17)

PMID Text
25636200 GADS deficient T cells displayed similar levels of T cell receptor -induced SLP-76 and PLC-gamma1 phosphorylation but exhibited substantial decrease in TCR-induced IL-2 and IFN-gamma release.
25452106 Gads was dispensable for TCR-induced phosphorylation of SLP-76, but was a dose-dependent amplifier of TCR-induced CD69 expression.
23399893 GADS mediates lymphoid disease downstream of BCR-ABL through the recruitment of specific signaling intermediates.
21179510 Histidine domain-protein tyrosine phosphatase interacts with Grb2 and GrpL
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20079431 The results show that Bcr-Abl regulates the actin cytoskeleton and non-apoptotic membrane blebbing via a GADS/Slp-76/Nck1 adaptor protein pathway.
19817957 Observational study of gene-disease association. (HuGE Navigator)
19027225 Consistent Grap-2 expression suggests a specific role for this adaptor in human medullary thyroid carcinoma, while qualitative alterations do not appear to influence RET signaling
18295596 Our findings define a pathway involving CD28 binding to Grb-2 and its co-operativity with Vav1 in the regulation of T-cell co-stimulation.
More...

AA Sequence

MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAEN      1 - 70
LLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQ     71 - 140
KQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPA    141 - 210
PQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALY    211 - 280
DFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR                        281 - 330
//

Text Mined References (64)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25636200 2015 GADS is required for TCR-mediated calcium influx and cytokine release, but not cellular adhesion, in human T cells.
25452106 2015 Modulation of TCR responsiveness by the Grb2-family adaptor, Gads.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23399893 2013 Gads (Grb2-related adaptor downstream of Shc) is required for BCR-ABL-mediated lymphoid leukemia.
More...