Property Summary

NCBI Gene PubMed Count 65
PubMed Score 175.27
PubTator Score 104.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Multiple myeloma 1.176 1.6e-02
malignant mesothelioma -1.400 1.5e-06
osteosarcoma 3.137 3.1e-07
medulloblastoma, large-cell -1.400 8.7e-04
Duchenne muscular dystrophy 1.677 1.1e-07
autosomal dominant Emery-Dreifuss muscul... 1.681 1.6e-03
fascioscapulohumeral muscular dystrophy 1.131 6.9e-04
juvenile dermatomyositis 1.774 3.8e-14
Amyotrophic Lateral Sclerosis 1.015 1.4e-04
acute quadriplegic myopathy 1.843 2.8e-06
primary pancreatic ductal adenocarcinoma 1.099 1.6e-02
lung cancer -1.400 7.4e-03
Parkinson's disease -1.300 4.9e-02
Breast cancer 3.800 2.2e-02
primary Sjogren syndrome 1.200 5.0e-02
lung adenocarcinoma 1.447 3.1e-07
Alzheimer's disease -1.100 2.6e-02
Pick disease -1.300 1.4e-05
ovarian cancer 1.500 6.5e-05
dermatomyositis 1.700 1.8e-03

Gene RIF (54)

PMID Text
26684753 Placental (P)RR can be involved in blood pressure regulation via the tissue RAS. On the other hand, plasma s(P)RR may be involved in the pathogenesis of decreased renal function in preeclampsia.
26625836 the present results suggest that ATP6AP2 rs5918007T might be susceptible factors for Essential Hypertension in Chinese Han population.
26582775 Study identifies a renin-angiotensin system-independent function for the (P)RR in the regulation of LDL metabolism by controlling the levels of SORT1 and LDL receptor.
26467484 A mutation in the splice site following exon 2 may affect splicing due to its close proximity to the exon-intron boundary. It was associated with epilepsy, Parkinsonism and intellectual disability in 2 brothers.
26272612 a novel GLP1R Interacting Protein ATP6ap2
25802486 MicroRNA-152 represses VEGF and TGFbeta1 expressions through post-transcriptional inhibition of prorenin receptor in human retinal endothelial cells.
25747895 This is the first demonstration that (P)RR may be profoundly involved in ductal tumorigenesis in the pancreas.
25720494 Data indicate that (pro)renin receptor ATP6PA2 interacts with the E1 beta subunit of pyruvate dehydrogenase and controlling its protein stability
25697868 Prorenin receptor promotes atrial structural and electric remodeling and plays an important role in the pathological development of atrial fibrillation.
25681793 Crosstalk between (Pro)renin receptor and COX-2 in the renal medulla during angiotensin II-induced hypertension
25668351 markedly expressed in adrenocortical zona glomerulosa and aldosterone-producing adenoma
25503726 expressed by lymphocytes and macrophages
25503453 activation of (P)RR and AT1R is associated with the pathogenesis of conjunctival EMZL by stimulating the production of FGF2 and MMPs.
25491485 Demonstrate that there are strong interactions between prorenin, ATP6AP2, and TGFB1 and that this system has a greater capacity in female amnion to stimulate profibrotic pathways, thus maintaining the integrity of the fetal membranes.
24591529 The binding of prorenin to PRR can promote proliferation and upregulate the anti-apoptotic protein Bcl-2 and downregulate the pro-apoptotic protein Bax independently
24472541 This study demonstrates that the the extracellular domain of ATP6AP2 participates in dimerization.
24424509 The aim of this study was to analyse the contribution of constitutive (P)RR activity to its cellular effects and the relevance of prorenin glycosylation on its ligand activity.
24400720 Studies indicated that various polymorphisms in the (P)RR/ATP6ap2 gene associated with increased cardiovascular risks.
24223829 The extracellular domain (ECD) and transmembrane domain (TM) of ATP6AP2 were indispensable for the biogenesis of active V-ATPase.
24218434 Plasma sPRR concentrations are dependent on ethnicity and independent of renin, prorenin, and aldosterone concentrations in healthy subjects and in patients with contrasted degrees of renin-angiotensin system activity.
23673200 Plasma levels of prorenin receptor are increased in heart failure patients with renal dysfunction.
23595882 Results show that reduction of the full-size ATP6AP2 transcript in XPDS cells and decreased level of ATP6AP2 protein in XPDS brain may compromise V-ATPase function and may ultimately be responsible for the pathology.
23555874 High s(P)RR concentration is associated with a lower SGA birth likelihood.
23277024 The(pro)renin receptor mediates EGF receptor transactivation in both Ang II-dependent and -independent pathways.
23111329 These in vitro data indicate that prorenin acidified in vivo possibly modulate renin angiotensin system in (pro)renin receptor-dependent and/or -independent manners which could ultimately lead to the pathogenesis of diseases.
23045457 Data indicate that high circulating levels of s(P)RR at early pregnancy predicted a subsequent elevation in blood pressure, and high concentrations at delivery were significantly associated with preeclampsia.
22930161 Our data using human samples provide the first evidence that prorenin receptor is associated with angiogenic activity in proliferative diabetic retinopathy.
22884881 The expression of (P)RR in erythroid cells, raising the possibility that (P)RR may have a role in erythropoiesis and the pathophysiology of certain types of anemia.
22721990 Prorenin is a chemotactic factor for human aortic smooth muscle cells expressing prorenin receptor.
22684035 Pro)renin receptor and insulin resistance: possible roles of angiotensin II-dependent and -independent pathways. [review]
22407459 Report the presence of prorenin receptor in human substantia nigra.
22025376 Angiotensin generation depending on prorenin-(P)RR interaction may occur in transgenic rodents overexpressing prorenin several 100-fold.
21997900 (P)RR gene activity may be controlled by intracellular AngII.
21420935 the crystal structure of the PRR-IC domain as maltose-binding protein (MBP) fusion proteins at 2.0A (maltose-free) and 2.15A (maltose-bound) was reported.
21346687 that (P)RR influences blood pressure regulation in Caucasian men, potentially through altered aldosterone release
21316680 Report expression (pro)renin receptors and angiotensin converting enzyme 2/angiotensin-(1-7)/Mas receptor axis in human aortic valve stenosis.
21270819 Prorenin receptor is mainly localized in the subcellular organelles, such as the endoplasmic reticulum and Golgi apparatus, and the prorenin receptor is cleaved by ADAM19 in the Golgi, resulting in two fragments.
21228785 The polymorphism of the (P)RR gene +1513A>G is associated with lacunar infarction and left ventricular hypertrophy in Japanese women. These results suggest that (P)RR has a role in organ damage in humans
20702505 Decidual prorenin may be involved in the labour-associated increase in amnion PGHS-2 abundance via the (pro)renin receptor.
20385187 Expression of (pro)renin receptor in human kidneys with end-stage kidney disease due to diabetic nephropathy
20093472 results reveal an unsuspected role for the prorenin receptor, V-ATPase activity, and acidification during Wnt/beta-catenin signaling
19733264 prospective crucial regions in renin and prorenin responsible for their interaction with the (pro)renin receptor [PRR] were investigated using various kinds of peptides
19641301 (Pro)renin receptor may contribute to the generation of arterial angiotensin II in kidney failure patients
19580809 Demonstrate that the (pro)renin receptor (PRR) is expressed in retinal pigment epithelium and may have a role in hypertensive exacerbation of dry age-related macular degeneration.
19513539 prorenin, renin and the peptides bind to (P)RR and the decoy reduces prorenin binding, supporting our hypothesis that decoy peptide region has a crucial role in prorenin binding.
19131936 polymorphism of the renin receptor gene is associated with ambulatory blood pressure in Japanese men
19131936 Observational study of gene-disease association. (HuGE Navigator)
18698213 equal ligand activities of both, renin and prorenin, on the (pro)renin receptor - promyelocytic zinc finger protein-phosphatidylinositol-3 kinase-p85alpha pathway
17494887 evidence for the AngII-independent MAPK activation by human (pro)renin receptor and induction of glomerulosclerosis with increased TGF-beta1 expression
17082479 existence of a novel signal transduction pathway involving the ligand renin, renin receptor, and the transcription factor PLZF
16807542 Human prorenin receptor directly or indirectly contributes to the regulation of renal cortical COX-2 expression.
16401765 Renin receptor overexpression has resulted in increased intraadrenal angiotensin II, thereby provoking enhanced aldosterone generation in the absence of changes in plasma renin.
15746149 specific role for the in cognitive functions and brain development
12045255 expression cloning of the human renin receptor complementary DNA encoding a 350-amino acid protein with a single transmembrane domain and no homology with any known membrane protein

AA Sequence

MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFH      1 - 70
RPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKA     71 - 140
NSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPD    141 - 210
LYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTI    211 - 280
LEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD    281 - 350
//

Text Mined References (70)

PMID Year Title
26684753 2016 Placental (pro)renin receptor expression and plasma soluble (pro)renin receptor levels in preeclampsia.
26625836 2015 Association of ATP6AP2 Gene Polymorphisms with Essential Hypertension in a South Chinese Han Population.
26582775 2016 Identification of the (Pro)renin Receptor as a Novel Regulator of Low-Density Lipoprotein Metabolism.
26467484 2015 A splice site mutation in ATP6AP2 causes X-linked intellectual disability, epilepsy, and parkinsonism.
26272612 2015 A Novel GLP1 Receptor Interacting Protein ATP6ap2 Regulates Insulin Secretion in Pancreatic Beta Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25802486 2015 MicroRNA-152 represses VEGF and TGF?1 expressions through post-transcriptional inhibition of (Pro)renin receptor in human retinal endothelial cells.
25747895 2015 (Pro)renin receptor is crucial for Wnt/?-catenin-dependent genesis of pancreatic ductal adenocarcinoma.
25720494 2015 ATP6AP2/(pro)renin receptor contributes to glucose metabolism via stabilizing the pyruvate dehydrogenase E1 ? subunit.
25697868 2015 Heart-specific overexpression of (pro)renin receptor induces atrial fibrillation in mice.
25681793 2015 Crosstalk between (Pro)renin receptor and COX-2 in the renal medulla during angiotensin II-induced hypertension.
25668351 2015 Expression and functional role of the prorenin receptor in the human adrenocortical zona glomerulosa and in primary aldosteronism.
25503726 2015 A functional (pro)renin receptor is expressed in human lymphocytes and monocytes.
25503453 2014 Involvement of the receptor-associated prorenin system in the pathogenesis of human conjunctival lymphoma.
25491485 2015 Effects of Fetal Sex on Expression of the (Pro)renin Receptor and Genes Influenced by its Interaction With Prorenin in Human Amnion.
24591529 2014 Binding of prorenin to (pro)renin receptor induces the proliferation of human umbilical artery smooth muscle cells via ROS generation and ERK1/2 activation.
24472541 2014 Participation of the extracellular domain in (pro)renin receptor dimerization.
24424509 2014 The (pro)renin receptor mediates constitutive PLZF-independent pro-proliferative effects which are inhibited by bafilomycin but not genistein.
24400720 2014 (Pro)renin receptor and V-ATPase: from Drosophila to humans.
24223829 2013 The role of individual domains and the significance of shedding of ATP6AP2/(pro)renin receptor in vacuolar H(+)-ATPase biogenesis.
24218434 2014 Plasma soluble (pro)renin receptor is independent of plasma renin, prorenin, and aldosterone concentrations but is affected by ethnicity.
23673200 2013 Increased plasma soluble (pro)renin receptor levels are correlated with renal dysfunction in patients with heart failure.
23595882 2013 Altered splicing of ATP6AP2 causes X-linked parkinsonism with spasticity (XPDS).
23555874 2013 Association between soluble (Pro)renin receptor concentration in cord blood and small for gestational age birth: a cross-sectional study.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23277024 2013 Role of (pro)renin receptor in Ang II-mediated EGF receptor transactivation.
23111329 2012 Acid-activated prorenin binds to (pro)renin receptor in vitro.
23045457 2012 Soluble (pro)renin receptor and blood pressure during pregnancy: a prospective cohort study.
22930161 2012 (Pro)renin receptor is associated with angiogenic activity in proliferative diabetic retinopathy.
22884881 2012 Expression of (pro)renin receptor in human erythroid cell lines and its increased protein accumulation by interferon-?.
22721990 2012 Chemotactic effect of prorenin on human aortic smooth muscle cells: a novel function of the (pro)renin receptor.
22684035 2013 (Pro)renin receptor and insulin resistance: possible roles of angiotensin II-dependent and -independent pathways.
22407459 2013 Expression of angiotensinogen and receptors for angiotensin and prorenin in the monkey and human substantia nigra: an intracellular renin-angiotensin system in the nigra.
22025376 2011 Renin- and prorenin-induced effects in rat vascular smooth muscle cells overexpressing the human (pro)renin receptor: does (pro)renin-(pro)renin receptor interaction actually occur?
21997900 2012 (Pro)renin receptor: another member of the system controlled by angiotensin II?
21420935 2011 Structural analysis of the intracellular domain of (pro)renin receptor fused to maltose-binding protein.
21346687 2011 Association of (pro)renin receptor gene polymorphism with blood pressure in Caucasian men.
21316680 2011 (Pro)renin receptors and angiotensin converting enzyme 2/angiotensin-(1-7)/Mas receptor axis in human aortic valve stenosis.
21270819 2011 The (pro)renin receptor is cleaved by ADAM19 in the Golgi leading to its secretion into extracellular space.
21269460 2011 Initial characterization of the human central proteome.
21228785 2011 Association of (pro)renin receptor gene polymorphisms with lacunar infarction and left ventricular hypertrophy in Japanese women: the Ohasama study.
20702505 2011 Molecular evidence of a (pro)renin/ (pro)renin receptor system in human intrauterine tissues in pregnancy and its association with PGHS-2.
20385187 2010 Expression of (pro)renin receptor in human kidneys with end-stage kidney disease due to diabetic nephropathy.
20093472 2010 Requirement of prorenin receptor and vacuolar H+-ATPase-mediated acidification for Wnt signaling.
19733264 2009 Prorenin has high affinity multiple binding sites for (pro)renin receptor.
19641301 2009 Association of (pro)renin receptor mRNA expression with angiotensin-converting enzyme mRNA expression in human artery.
19580809 2009 (Pro)renin receptor is expressed in human retinal pigment epithelium and participates in extracellular matrix remodeling.
19513539 2009 'Decoy peptide' region (RIFLKRMPSI) of prorenin prosegment plays a crucial role in prorenin binding to the (pro)renin receptor.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19131936 2009 Association of (pro)renin receptor gene polymorphism with blood pressure in Japanese men: the Ohasama study.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18698213 2008 Prorenin engages the (pro)renin receptor like renin and both ligand activities are unopposed by aliskiren.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17494887 2007 Slowly progressive, angiotensin II-independent glomerulosclerosis in human (pro)renin receptor-transgenic rats.
17082479 2006 A novel signal transduction cascade involving direct physical interaction of the renin/prorenin receptor with the transcription factor promyelocytic zinc finger protein.
16807542 2006 Increased expression of cyclooxygenase-2 in the renal cortex of human prorenin receptor gene-transgenic rats.
16401765 2006 Elevated blood pressure and heart rate in human renin receptor transgenic rats.
16374430 2006 Renin increases mesangial cell transforming growth factor-beta1 and matrix proteins through receptor-mediated, angiotensin II-independent mechanisms.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15772651 2005 The DNA sequence of the human X chromosome.
15746149 2005 A unique exonic splice enhancer mutation in a family with X-linked mental retardation and epilepsy points to a novel role of the renin receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12045255 2002 Pivotal role of the renin/prorenin receptor in angiotensin II production and cellular responses to renin.
11782983 2002 Novel mental retardation-epilepsy syndrome linked to Xp21.1-p11.4.
11590366 2001 Identification, genomic structure, and screening of the vacuolar proton-ATPase membrane sector-associated protein M8-9 gene within the COD1 critical region (Xp11.4).
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
9556572 1998 Identification and characterization of a novel 9.2-kDa membrane sector-associated protein of vacuolar proton-ATPase from chromaffin granules.