Property Summary

NCBI Gene PubMed Count 65
Grant Count 34
R01 Count 24
Funding $2,056,660.36
PubMed Score 175.27
PubTator Score 104.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (54)

PMID Text
26684753 Placental (P)RR can be involved in blood pressure regulation via the tissue RAS. On the other hand, plasma s(P)RR may be involved in the pathogenesis of decreased renal function in preeclampsia.
26625836 the present results suggest that ATP6AP2 rs5918007T might be susceptible factors for Essential Hypertension in Chinese Han population.
26582775 Study identifies a renin-angiotensin system-independent function for the (P)RR in the regulation of LDL metabolism by controlling the levels of SORT1 and LDL receptor.
26467484 A mutation in the splice site following exon 2 may affect splicing due to its close proximity to the exon-intron boundary. It was associated with epilepsy, Parkinsonism and intellectual disability in 2 brothers.
26272612 a novel GLP1R Interacting Protein ATP6ap2
25802486 MicroRNA-152 represses VEGF and TGFbeta1 expressions through post-transcriptional inhibition of prorenin receptor in human retinal endothelial cells.
25747895 This is the first demonstration that (P)RR may be profoundly involved in ductal tumorigenesis in the pancreas.
25720494 Data indicate that (pro)renin receptor ATP6PA2 interacts with the E1 beta subunit of pyruvate dehydrogenase and controlling its protein stability
25697868 Prorenin receptor promotes atrial structural and electric remodeling and plays an important role in the pathological development of atrial fibrillation.
25681793 Crosstalk between (Pro)renin receptor and COX-2 in the renal medulla during angiotensin II-induced hypertension
More...

AA Sequence

MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFH      1 - 70
RPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKA     71 - 140
NSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPD    141 - 210
LYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTI    211 - 280
LEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD    281 - 350
//

Text Mined References (70)

PMID Year Title
26684753 2016 Placental (pro)renin receptor expression and plasma soluble (pro)renin receptor levels in preeclampsia.
26625836 2015 Association of ATP6AP2 Gene Polymorphisms with Essential Hypertension in a South Chinese Han Population.
26582775 2016 Identification of the (Pro)renin Receptor as a Novel Regulator of Low-Density Lipoprotein Metabolism.
26467484 2015 A splice site mutation in ATP6AP2 causes X-linked intellectual disability, epilepsy, and parkinsonism.
26272612 2015 A Novel GLP1 Receptor Interacting Protein ATP6ap2 Regulates Insulin Secretion in Pancreatic Beta Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25802486 2015 MicroRNA-152 represses VEGF and TGF?1 expressions through post-transcriptional inhibition of (Pro)renin receptor in human retinal endothelial cells.
25747895 2015 (Pro)renin receptor is crucial for Wnt/?-catenin-dependent genesis of pancreatic ductal adenocarcinoma.
25720494 2015 ATP6AP2/(pro)renin receptor contributes to glucose metabolism via stabilizing the pyruvate dehydrogenase E1 ? subunit.
25697868 2015 Heart-specific overexpression of (pro)renin receptor induces atrial fibrillation in mice.
More...