Property Summary

NCBI Gene PubMed Count 6
Grant Count 12
R01 Count 9
Funding $1,095,310.67
PubMed Score 30.31
PubTator Score 8.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

AA Sequence

MGRVEDGGTTEELEDWDPGTSALPAPGIKQGPREQTGTGPLSQKCWEPEPDAPSQPGPALWSRGRARTQA      1 - 70
LAGGSSLQQLDPENTGFIGADTFTGLVHSHELPLDPAKLDMLVALAQSNEQGQVCYQELVDLISSKRSSS     71 - 140
FKRAIANGQRALPRDGPLDEPGLGVYKRFVRYVAYEILPCEVDRRWYFYRHRSCPPPVFMASVTLAQIIV    141 - 210
FLCYGARLNKWVLQTYHPEYMKSPLVYHPGHRARAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHG    211 - 280
LLRISLLYLAGVLAGSLTVSITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMS    281 - 350
SEVGRAVWLRFSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFLLFAV    351 - 420
FWNVFAYDLLGAHIPPPP                                                        421 - 438
//

Text Mined References (7)

PMID Year Title
23263464 2013 Rhomboid proteins: a role in keratinocyte proliferation and cancer.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
9662444 1998 Characterization of a mammalian cDNA encoding a protein with high sequence similarity to the Drosophila regulatory protein Rhomboid.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.