Property Summary

NCBI Gene PubMed Count 10
PubMed Score 30.59
PubTator Score 8.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.500 1.7e-04
Astrocytoma, Pilocytic -1.100 1.3e-05
atypical teratoid / rhabdoid tumor -1.100 3.2e-04
ependymoma -1.400 1.1e-04
glioblastoma -1.500 8.9e-11
group 3 medulloblastoma -1.800 2.8e-04
medulloblastoma, large-cell -1.400 3.9e-05
pituitary cancer 1.100 4.8e-04
primitive neuroectodermal tumor -1.100 1.5e-03

Protein-protein Interaction (4)

AA Sequence

MGRVEDGGTTEELEDWDPGTSALPAPGIKQGPREQTGTGPLSQKCWEPEPDAPSQPGPALWSRGRARTQA      1 - 70
LAGGSSLQQLDPENTGFIGADTFTGLVHSHELPLDPAKLDMLVALAQSNEQGQVCYQELVDLISSKRSSS     71 - 140
FKRAIANGQRALPRDGPLDEPGLGVYKRFVRYVAYEILPCEVDRRWYFYRHRSCPPPVFMASVTLAQIIV    141 - 210
FLCYGARLNKWVLQTYHPEYMKSPLVYHPGHRARAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHG    211 - 280
LLRISLLYLAGVLAGSLTVSITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMS    281 - 350
SEVGRAVWLRFSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFLLFAV    351 - 420
FWNVFAYDLLGAHIPPPP                                                        421 - 438
//

Text Mined References (11)

PMID Year Title