Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 5
Funding $231,246
PubMed Score 16.74
PubTator Score 24.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 2.400 0.000
glioblastoma -2.100 0.000
group 4 medulloblastoma -2.500 0.000
cystic fibrosis -1.179 0.000
medulloblastoma, large-cell -2.100 0.000
breast carcinoma -1.800 0.000
fibroadenoma -1.800 0.008
adult high grade glioma -1.800 0.000
atypical teratoid/rhabdoid tumor -1.100 0.000
ductal carcinoma in situ -1.700 0.001
invasive ductal carcinoma -1.700 0.012
psoriasis -1.500 0.000

AA Sequence

MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDL      1 - 70
RRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQ     71 - 140
TPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDET    141 - 210
KVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQP    211 - 280
GEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEP    281 - 350
PTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM                                     351 - 387
//

Text Mined References (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16386234 2006 Paralemmin interacts with D3 dopamine receptors: implications for membrane localization and cAMP signaling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...