Tbio | Paralemmin-1 |
Involved in plasma membrane dynamics and cell process formation. Isoform 1 and isoform 2 are necessary for axonal and dendritic filopodia induction, for dendritic spine maturation and synapse formation in a palmitoylation-dependent manner.
This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq, Jul 2008]
This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 8.10857354318793E-38 |
malignant mesothelioma | 3163 | 3.73819540583434E-8 |
group 4 medulloblastoma | 1875 | 1.08961073365995E-7 |
adult high grade glioma | 2148 | 2.63949364203763E-5 |
atypical teratoid/rhabdoid tumor | 1095 | 5.34792505784368E-5 |
cystic fibrosis | 1670 | 8.85008746074769E-5 |
breast carcinoma | 1614 | 1.14736978020118E-4 |
glioblastoma | 5572 | 2.27942325184893E-4 |
medulloblastoma, large-cell | 6234 | 3.50863167755081E-4 |
ductal carcinoma in situ | 1745 | 7.44153476906814E-4 |
fibroadenoma | 557 | 0.00829248212811618 |
invasive ductal carcinoma | 2950 | 0.0117687206328493 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Vesicoureteral reflux | 28 | 3.369 | 1.7 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | 2.400 | 0.000 |
glioblastoma | -2.100 | 0.000 |
group 4 medulloblastoma | -2.500 | 0.000 |
cystic fibrosis | -1.179 | 0.000 |
medulloblastoma, large-cell | -2.100 | 0.000 |
breast carcinoma | -1.800 | 0.000 |
fibroadenoma | -1.800 | 0.008 |
adult high grade glioma | -1.800 | 0.000 |
atypical teratoid/rhabdoid tumor | -1.100 | 0.000 |
ductal carcinoma in situ | -1.700 | 0.001 |
invasive ductal carcinoma | -1.700 | 0.012 |
psoriasis | -1.500 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Chicken | OMA Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA Inparanoid |
MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDL 1 - 70 RRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQ 71 - 140 TPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDET 141 - 210 KVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQP 211 - 280 GEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEP 281 - 350 PTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM 351 - 387 //
PMID | Year | Title |
---|---|---|
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. |
22223895 | 2012 | Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features. |
20068231 | 2010 | Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. |
19413330 | 2009 | Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. |
18669648 | 2008 | A quantitative atlas of mitotic phosphorylation. |
17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
17081983 | 2006 | Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. |
16386234 | 2006 | Paralemmin interacts with D3 dopamine receptors: implications for membrane localization and cAMP signaling. |
16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
More... |