Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.74
PubTator Score 24.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 8.10857354318793E-38
malignant mesothelioma 3163 3.73819540583434E-8
group 4 medulloblastoma 1875 1.08961073365995E-7
adult high grade glioma 2148 2.63949364203763E-5
atypical teratoid/rhabdoid tumor 1095 5.34792505784368E-5
cystic fibrosis 1670 8.85008746074769E-5
breast carcinoma 1614 1.14736978020118E-4
glioblastoma 5572 2.27942325184893E-4
medulloblastoma, large-cell 6234 3.50863167755081E-4
ductal carcinoma in situ 1745 7.44153476906814E-4
fibroadenoma 557 0.00829248212811618
invasive ductal carcinoma 2950 0.0117687206328493
Disease Target Count Z-score Confidence
Vesicoureteral reflux 28 3.369 1.7

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 2.400 0.000
glioblastoma -2.100 0.000
group 4 medulloblastoma -2.500 0.000
cystic fibrosis -1.179 0.000
medulloblastoma, large-cell -2.100 0.000
breast carcinoma -1.800 0.000
fibroadenoma -1.800 0.008
adult high grade glioma -1.800 0.000
atypical teratoid/rhabdoid tumor -1.100 0.000
ductal carcinoma in situ -1.700 0.001
invasive ductal carcinoma -1.700 0.012
psoriasis -1.500 0.000

Synonym

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Pathway (1)

AA Sequence

MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDL      1 - 70
RRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQ     71 - 140
TPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDET    141 - 210
KVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQP    211 - 280
GEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEP    281 - 350
PTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM                                     351 - 387
//

Text Mined References (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16386234 2006 Paralemmin interacts with D3 dopamine receptors: implications for membrane localization and cAMP signaling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...