Property Summary

NCBI Gene PubMed Count 15
PubMed Score 17.23
PubTator Score 24.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.800 2.6e-05
Astrocytoma, Pilocytic -1.100 1.3e-04
atypical teratoid/rhabdoid tumor -1.100 5.3e-05
breast carcinoma -1.800 1.1e-04
cystic fibrosis -1.179 8.9e-05
ductal carcinoma in situ -1.700 7.4e-04
fibroadenoma -1.800 8.3e-03
glioblastoma -1.700 8.1e-07
group 3 medulloblastoma -1.800 3.1e-03
invasive ductal carcinoma -1.700 1.2e-02
malignant mesothelioma 2.400 3.7e-08
medulloblastoma, large-cell -2.100 3.5e-04
psoriasis -1.500 8.1e-38

 GO Function (1)

AA Sequence

MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDL      1 - 70
RRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQ     71 - 140
TPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDET    141 - 210
KVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQP    211 - 280
GEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEP    281 - 350
PTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM                                     351 - 387
//

Text Mined References (21)

PMID Year Title