Property Summary

NCBI Gene PubMed Count 52
PubMed Score 26.86
PubTator Score 119.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.200 1.0e-05
non primary Sjogren syndrome sicca -1.300 2.0e-02
osteosarcoma -1.428 1.4e-04
Rheumatoid arthritis -1.500 7.1e-03

Protein-protein Interaction (4)

Gene RIF (28)

AA Sequence

MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGAD      1 - 70
LYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGG     71 - 140
LTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTA    141 - 210
VVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDT    211 - 280
IEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWGTSEQSATLQGDQT                          281 - 328
//

Text Mined References (56)

PMID Year Title