Property Summary

NCBI Gene PubMed Count 48
Grant Count 42
R01 Count 38
Funding $1,840,810.9
PubMed Score 24.40
PubTator Score 119.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis -1.500 0.007
malignant mesothelioma 1.200 0.000
osteosarcoma -1.428 0.000
non primary Sjogren syndrome sicca -1.300 0.020

Gene RIF (25)

PMID Text
26261251 RAD51C and RAD51D are moderate ovarian cancer susceptibility genes.
26057125 a mutation analysis in 171 high-risk BRCA1 and BRCA2 negative ovarian cancer patients, to evaluate the frequency of hereditary RAD51C and RAD51D variants in Czech population, is reported.
24130102 We aimed to determine the prevalence of germline RAD51D mutations in Spanish breast and ovarian cancer families negative for BRCA1/BRCA2
24088786 endogenous regulation of RAD51D by miR-103/107 was observed in several tumor subtypes; both miR-103 and miR-107 directly target and regulate RAD51 and RAD51D
23372765 Our data provide additional evidence that RAD51D mutations are enriched among ovarian cancer patients, but are extremely rare among familial breast cancer patients.
22986143 loss-of-function mutations in RAD51D predispose to ovarian carcinoma but not to breast carcinoma.
22752287 the contribution of RAD51C and RAD51D gene mutations to an inherited high risk of ovarian cancer is very small
22652533 RAD51D is primarily a moderate penetrance susceptibility gene for ovarian cancer, with clinical significance for the carriers.
22415235 The RAD51D should be included in genetic screening of ovarian cancer families that do not have BRCA1/BRCA2 mutations.
21822267 These data indicate that RAD51D mutation testing may have clinical utility in individuals with ovarian cancer and their families.
More...

AA Sequence

MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGAD      1 - 70
LYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGG     71 - 140
LTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTA    141 - 210
VVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDT    211 - 280
IEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWGTSEQSATLQGDQT                          281 - 328
//

Text Mined References (51)

PMID Year Title
26261251 2015 Contribution of Germline Mutations in the RAD51B, RAD51C, and RAD51D Genes to Ovarian Cancer in the Population.
26057125 2015 Mutation Analysis of the RAD51C and RAD51D Genes in High-Risk Ovarian Cancer Patients and Families from the Czech Republic.
25416956 2014 A proteome-scale map of the human interactome network.
24141787 2014 Breast cancer-associated missense mutants of the PALB2 WD40 domain, which directly binds RAD51C, RAD51 and BRCA2, disrupt DNA repair.
24130102 2014 About 1% of the breast and ovarian Spanish families testing negative for BRCA1 and BRCA2 are carriers of RAD51D pathogenic variants.
24088786 2013 Systematic screen identifies miRNAs that target RAD51 and RAD51D to enhance chemosensitivity.
23372765 2013 Analysis of RAD51D in ovarian cancer patients and families with a history of ovarian or breast cancer.
23149936 2013 Rad51 paralog complexes BCDX2 and CX3 act at different stages in the BRCA1-BRCA2-dependent homologous recombination pathway.
22986143 2012 Loss of function germline mutations in RAD51D in women with ovarian carcinoma.
22752287 2012 High sensitivity for BRCA1/2 mutations in breast/ovarian kindreds: are there still other breast/ovary genes to be discovered?
More...