Property Summary

NCBI Gene PubMed Count 10
PubMed Score 54.97
PubTator Score 32.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

 GO Component (1)

Gene RIF (8)

AA Sequence

MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKV      1 - 70
LIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKKREDPKTRRDSVDSKSSASSS     71 - 140
PKRPSVERSNSSKSKAESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGV    141 - 210
NCDKMASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDEL    211 - 280
RELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC      281 - 348
//

Text Mined References (14)

PMID Year Title