Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 5
Funding $385,145.34
PubMed Score 53.21
PubTator Score 32.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Synonym

Accession O75764 A8K2K7 Q5DR83
Symbols TFIIS
TFIIS.H

Gene

PANTHER Protein Class (1)

Gene RIF (7)

PMID Text
26498664 TCEA3 attenuates the proliferation and induces apoptosis of gastric cancer cells
23357533 Tcea3 binds to TGF-beta I receptor and activates TGF-beta signaling pathway.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20178742 Study demonstrates a strong synergy between hPAF1C and elongation factor SII/TFIIS and an underlying mechanism involving direct hPAF1C-SII interactions and cooperative binding to RNA polymerase II.
19913121 Observational study of gene-disease association. (HuGE Navigator)
9765201 TFIIS synergizes with HIV-1 Tat during transactivation of the HIV-1 LTR promoter
1559613 TFIIS synergizes with HIV-1 Tat during transactivation of the HIV-1 LTR promoter

AA Sequence

MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKV      1 - 70
LIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKKREDPKTRRDSVDSKSSASSS     71 - 140
PKRPSVERSNSSKSKAESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGV    141 - 210
NCDKMASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDEL    211 - 280
RELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC      281 - 348
//

Text Mined References (13)

PMID Year Title
26498664 2015 TCEA3 Attenuates Gastric Cancer Growth by Apoptosis Induction.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23357533 2013 TCEA3 binds to TGF-beta receptor I and induces Smad-independent, JNK-dependent apoptosis in ovarian cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20178742 2010 The human PAF1 complex acts in chromatin transcription elongation both independently and cooperatively with SII/TFIIS.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...