Property Summary

Ligand Count 199
NCBI Gene PubMed Count 123
PubMed Score 848.28
PubTator Score 407.96

Knowledge Summary

Patent (28,792)

Expression

  Differential Expression (9)

Disease log2 FC p
colon cancer -2.600 3.6e-06
gastric carcinoma 1.600 2.2e-03
intraductal papillary-mucinous adenoma (... 1.600 1.4e-02
intraductal papillary-mucinous carcinoma... 1.800 2.9e-02
malignant mesothelioma -1.500 2.4e-06
osteosarcoma 1.561 2.3e-02
ovarian cancer -1.800 3.7e-17
psoriasis 1.400 2.0e-14
ulcerative colitis 1.300 9.8e-04

Gene RIF (120)

AA Sequence

MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYA      1 - 70
AAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQ     71 - 140
GMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGS    141 - 210
KECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAA    211 - 280
TQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILAT    281 - 350
ASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA    351 - 420
CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAA    421 - 490
KNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGH    491 - 560
AKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYL    561 - 630
PECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNH    631 - 700
PVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLI    701 - 770
KTCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY    771 - 840
FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFS    841 - 910
MMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQV    911 - 980
ELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYR    981 - 1050
LKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP    1051 - 1119
//

Text Mined References (125)

PMID Year Title