Property Summary

NCBI Gene PubMed Count 104
Grant Count 260
R01 Count 176
Funding $35,377,705.98
PubMed Score 751.57
PubTator Score 407.96

Knowledge Summary

Patent (28,792)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -7.400 0.000
osteosarcoma 1.561 0.023
intraductal papillary-mucinous adenoma (... 1.600 0.014
intraductal papillary-mucinous carcinoma... 1.800 0.029
colon cancer -2.600 0.000
gastric carcinoma 1.600 0.002
ulcerative colitis 1.300 0.001
ovarian cancer -1.800 0.000
psoriasis 1.400 0.000

Synonym

Accession O75762 A6NIN6
Symbols FEPS
ANKTM1

Gene

PDB

3J9P  

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2770 screening 0 / 0 / 3 Late stage counterscreen results from the probe development effort to identify selective agonists of the Transient Receptor Potential Channels 3 (TRPML3): other ion channel Fura-2 profiling assay

Gene RIF (101)

PMID Text
27333657 It is expressed in the unmyelinated C fiber nociceptors and activated by various nociceptive stimuli causing pain in our body.(review)
26530852 TRPA1 was expressed in all studied regions (tongue, epiglottis, and pharynx), but was always localized below the basal lamina. No immunoreactivity for TRPA1 was found on epithelial cells.
26504357 exposure to cigarette smoke extract initially causes an increase in the extracellular level of ROS, which in turn activates lung epithelial TRPA1
26358221 the inflammatory cytokine TNF-a can modulate the activity of the mechanosensitive ion channels TRPA1 and TRPV4 in odontoblasts via the p38 MAPK pathway but has differential effects on their expression.
26330615 Certain TRPA1 variants and tyrosine-to-phenylalanine mutants exhibited good function compared with non-mutated TRPA1 in transfected HEK293 cells
26283426 These findings suggest that the TRPA1-TRPV1 interaction may play an important role in regulating the function and excitability of pulmonary sensory neurons during airway inflammation
26054320 Hypothermia mediates its effects on monocytes through TRPA1.
26046936 Report activation of TRPA1 by o-chlorobenzylidene malononitrile as model of neuropathic pain.
26039217 TRPA1 activity may modulate asthma, particularly among individuals living in locations prone to high levels of air pollution.
25911511 Levels of the TRPV4 agonist 5,6-EET, but not levels of TRPV1 or TRPA1 agonists, were increased in IBS biopsies compared with controls.
More...

AA Sequence

MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYA      1 - 70
AAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQ     71 - 140
GMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGS    141 - 210
KECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAA    211 - 280
TQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILAT    281 - 350
ASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA    351 - 420
CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAA    421 - 490
KNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGH    491 - 560
AKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYL    561 - 630
PECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNH    631 - 700
PVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLI    701 - 770
KTCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY    771 - 840
FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFS    841 - 910
MMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQV    911 - 980
ELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYR    981 - 1050
LKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP    1051 - 1119
//

Text Mined References (106)

PMID Year Title
27333657 2016 [Thermosensitive TRP channels and brain function].
26530852 2016 Localization and expression of TRPV1 and TRPA1 in the human oropharynx and larynx.
26504357 2015 Lung Epithelial TRPA1 Transduces the Extracellular ROS into Transcriptional Regulation of Lung Inflammation Induced by Cigarette Smoke: The Role of Influxed Ca²?.
26358221 2015 TNF-?-induced p38MAPK activation regulates TRPA1 and TRPV4 activity in odontoblast-like cells.
26330615 2015 Genetic variants affecting human TRPA1 or TRPM8 structure can be classified in vitro as 'well expressed', 'poorly expressed' or 'salvageable'.
26283426 2015 Interaction between TRPA1 and TRPV1: Synergy on pulmonary sensory nerves.
26054320 2015 TRPA1 mediates the effects of hypothermia on the monocyte inflammatory response.
26046936 2015 Towards Development of a Dermal Pain Model: In Vitro Activation of Rat and Human Transient Receptor Potential Ankyrin Repeat 1 and Safe Dermal Injection of o-Chlorobenzylidene Malononitrile to Rat.
26039217 2015 Activation of Transient Receptor Potential Ankyrin-1 by Insoluble Particulate Material and Association with Asthma.
25911511 2015 Quantification and Potential Functions of Endogenous Agonists of Transient Receptor Potential Channels in Patients With Irritable Bowel Syndrome.
More...