Property Summary

Ligand Count 2
NCBI Gene PubMed Count 74
PubMed Score 125.25
PubTator Score 85.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.760 2.4e-06
colon cancer 1.400 1.8e-05
ductal carcinoma in situ -1.300 1.0e-02
ependymoma 2.500 1.0e-04
facioscapulohumeral dystrophy -1.700 4.6e-02
intraductal papillary-mucinous adenoma (... 1.700 4.0e-03
intraductal papillary-mucinous carcinoma... 1.600 2.1e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.6e-02
invasive ductal carcinoma -1.600 1.1e-02
lung cancer -1.800 2.0e-04
lung carcinoma -1.300 8.0e-04
malignant mesothelioma -3.700 1.7e-07
non-small cell lung cancer -1.585 2.0e-15
pancreatic cancer 1.600 2.5e-04

Gene RIF (56)

AA Sequence

MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALAERCGWSPEEE      1 - 70
WNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTI     71 - 140
VSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYGRIVIYLLSCLGVGVTGVVVAFAPNFPVFVI    141 - 210
FRFLQGVFGKGTWMTCYVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFL    211 - 280
FLLYYWVVPESPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKC    281 - 350
TLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA    351 - 420
CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAPFLLFR    421 - 490
LAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHSCKCGRNKKTPVSRSHL        491 - 556
//

Text Mined References (76)

PMID Year Title