Property Summary

NCBI Gene PubMed Count 70
PubMed Score 111.27
PubTator Score 85.41

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75751 Q5SYN6 Q9UP02
Symbols EMT
EMTH
OCT3

Gene

  Ortholog (11)

Gene RIF (52)

PMID Text
25920679 Findings suggest that OCT3 plays an important role in the absorption and elimination of metformin and that the transporter is a critical determinant of metformin bioavailability, clearance, and pharmacologic action.
25883089 Findings suggest specific involvement of each organic cation transporters (OCT1-3) in drug transportation.
25561729 Findings suggest a negative feedback mechanism against inflammatory response by which solute carrier family 22 member 3 (SLC22A3) variant rs3088442 G-->A decreased the risk of coronary heart disease (CHD).
25322669 The markers of EMT were detected by using Western blot.
24471494 Cultured astroctye line 1321N1 and primary human astrocytes transport monoamines partly through OCT3.
23555006 There was no association between rs7758229 in 6q26-q27/SLC22A3 and the risk of colorectal cancer in a Chinese population.
23303678 Decreasing expression of OCT3 and MATE1 in human placenta indicates these transporters may play a role in fetal protection preferentially at earlier stages of gestation.
23071104 The increased Wnt3 in the trastuzumab-resistant cells also promoted a partial EMT-like transition.
23036009 The risk for coronary artery disease in a Chinese Han population is not associated with single nucleotide polymorphisms in the SLC22A3-LPAL2-LPA gene cluster.
22741436 PDLIM5 (rs17021918,T), SLC22A3 (rs9364554,C) and NKX3-1 (rs1512268,A) SNPs might not be associated with prostate cancer in Chinese men.
More...

AA Sequence

MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALAERCGWSPEEE      1 - 70
WNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTI     71 - 140
VSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYGRIVIYLLSCLGVGVTGVVVAFAPNFPVFVI    141 - 210
FRFLQGVFGKGTWMTCYVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFL    211 - 280
FLLYYWVVPESPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKC    281 - 350
TLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA    351 - 420
CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAPFLLFR    421 - 490
LAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHSCKCGRNKKTPVSRSHL        491 - 556
//

Text Mined References (72)

PMID Year Title
25920679 2015 Targeted disruption of organic cation transporter 3 attenuates the pharmacologic response to metformin.
25883089 2015 Functional characterization of the organic cation transporters (OCTs) in human airway pulmonary epithelial cells.
25561729 2015 A solute carrier family 22 member 3 variant rs3088442 G?A associated with coronary heart disease inhibits lipopolysaccharide-induced inflammatory response.
25322669 2014 Down-regulation of miR-140 induces EMT and promotes invasion by targeting Slug in esophageal cancer.
25208887 2014 Genetic variants in PLG, LPA, and SIGLEC 14 as well as smoking contribute to plasma plasminogen levels.
24471494 2014 Predominant role of plasma membrane monoamine transporters in monoamine transport in 1321N1, a human astrocytoma-derived cell line.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23555006 2013 Genetic variant rs7758229 in 6q26-q27 is not associated with colorectal cancer risk in a Chinese population.
23303678 2013 Organic cation transporter 3 (OCT3/SLC22A3) and multidrug and toxin extrusion 1 (MATE1/SLC47A1) transporter in the placenta and fetal tissues: expression profile and fetus protective role at different stages of gestation.
23071104 2012 Expression of Wnt3 activates Wnt/?-catenin pathway and promotes EMT-like phenotype in trastuzumab-resistant HER2-overexpressing breast cancer cells.
More...