Property Summary

NCBI Gene PubMed Count 38
PubMed Score 56.82
PubTator Score 49.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.800 4.2e-05
astrocytic glioma -1.300 3.3e-02
atypical teratoid / rhabdoid tumor -2.200 1.2e-07
Down syndrome -1.100 1.5e-02
ependymoma -1.200 1.7e-06
glioblastoma -1.300 2.8e-05
group 4 medulloblastoma -1.300 9.7e-04
intraductal papillary-mucinous neoplasm ... 1.500 2.4e-02
juvenile dermatomyositis -1.057 1.6e-07
lung cancer 1.200 1.9e-04
lung carcinoma 1.600 2.5e-31
malignant mesothelioma -1.800 5.7e-07
medulloblastoma, large-cell -2.200 1.7e-05
osteosarcoma -1.604 4.3e-02
ovarian cancer 1.800 6.2e-05
Pick disease -1.300 6.9e-03
primitive neuroectodermal tumor -1.400 5.8e-04
subependymal giant cell astrocytoma -1.180 3.5e-02

Gene RIF (29)

AA Sequence

MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTKDG      1 - 70
LISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTIIHHHIPFNWDCEFIRLHFGHN     71 - 140
RKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMVTIRSHMLTPFVEENLVSAAGGSI    141 - 210
SHQVSFSYFNAFNSLLNNMELVRKIYSTLAGTRKDVEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNA    211 - 280
SGRLTLADIERIAPLAEGALPYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLV    281 - 350
KTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTRR    351 - 420
DGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGLYKGAKACFLR    421 - 490
DIPFSAIYFPVYAHCKLLLADENGHVGGLNLLAAGAMAGVPAASLVTPADVIKTRLQVAARAGQTTYSGV    491 - 560
IDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQRWFYIDFGGLKPAGSEPTPKSRIADLPP    561 - 630
ANPDHIGGYRLATATFAGIENKFGLYLPKFKSPSVAVVQPKAAVAATQ                          631 - 678
//

Text Mined References (45)

PMID Year Title