Property Summary

NCBI Gene PubMed Count 20
PubMed Score 29.14
PubTator Score 63.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.100 6.5e-03
Astrocytoma, Pilocytic 1.800 1.3e-07
atypical teratoid / rhabdoid tumor 2.400 3.8e-05
breast carcinoma -1.400 1.1e-04
diabetes mellitus -1.100 3.3e-03
ductal carcinoma in situ -1.400 9.8e-04
ependymoma 1.400 1.7e-07
fibroadenoma -1.700 1.0e-02
glioblastoma 1.800 1.5e-06
group 4 medulloblastoma -1.600 8.0e-06
intraductal papillary-mucinous adenoma (... -1.300 5.7e-03
intraductal papillary-mucinous carcinoma... -1.400 8.8e-03
intraductal papillary-mucinous neoplasm ... -1.400 2.9e-02
invasive ductal carcinoma -1.761 1.1e-02
lung cancer -2.700 5.2e-04
medulloblastoma, large-cell 2.500 1.6e-05
oligodendroglioma 1.300 1.3e-02
osteosarcoma 3.628 4.1e-07
ovarian cancer -2.200 7.2e-10
psoriasis -1.800 1.1e-04
subependymal giant cell astrocytoma 1.678 2.4e-02

 GO Function (1)

Gene RIF (13)

AA Sequence

MEPGRRGAAALLALLCVACALRAGRAQYERYSFRSFPRDELMPLESAYRHALDKYSGEHWAESVGYLEIS      1 - 70
LRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLA     71 - 140
DFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLF    141 - 210
IRAVRAYNGENWRTSITDMELALPDFFKAFYECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEEN    211 - 280
LTPVIGGYPVEKFVATMYHYLQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDE    281 - 350
HFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS                       351 - 401
//

Text Mined References (23)

PMID Year Title