Property Summary

NCBI Gene PubMed Count 24
PubMed Score 193.01
PubTator Score 18776.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 2.48506878265967E-17
malignant mesothelioma 3163 8.44621473744163E-7
medulloblastoma, large-cell 6234 1.77586238894457E-6
lung cancer 4473 4.28337461533674E-6
pediatric high grade glioma 2712 4.91770129383456E-6
atypical teratoid / rhabdoid tumor 4369 6.93946543127301E-6
group 3 medulloblastoma 2254 9.08589676239838E-6
lung adenocarcinoma 2714 9.70779867749346E-6
primitive neuroectodermal tumor 3031 2.95715127969568E-5
glioblastoma 5572 6.4145943130026E-5
psoriasis 6685 3.65913459894701E-4
ovarian cancer 8492 4.69905377176305E-4
osteosarcoma 7933 7.01280685240529E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 9.9419990214881E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00346367671554382
active Crohn's disease 918 0.0107383079797003
colon cancer 1475 0.0122370195665475
Breast cancer 3099 0.0275551869816365
spina bifida 1064 0.0439364832154617
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (19)

Synonym

Accession O75717 C9JW18 F6W0U7
Symbols AND1
CTF4
AND-1
CHTF4

Gene

PDB

2D7L  

  Ortholog (15)

Gene RIF (14)

PMID Text
26082189 And-1 coordinates with Claspin for efficient Chk1 activation in response to replication stress.
25602958 RecQL4-dependent association of Mcm10 and Ctf4 with replication origins appears to be the first important step controlled by S phase promoting kinases and checkpoint pathways for the initiation of DNA replication in human cells.
24255107 The Ctf4-CMG complex contains a homodimeric Ctf4 that acts as a platform linking polymerase alpha to the monomeric hCMG complex.
23184928 And-1 together with HJURP regulates the assembly of new CENP-A onto centromeres.
23093411 Human And-1 facilitates loading of the MCM2-7 helicase onto chromatin during the assembly of prereplicative complex.
21725360 Data show that And-1 forms a complex with both histone H3 and Gcn5.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20089864 in human cells, hCtf4 plays an essential role in DNA replication and its ability to stimulate the replicative DNA polymerases may contribute to this effect
More...

AA Sequence

MPATRKPMRYGHTEGHTEVCFDDSGSFIVTCGSDGDVRIWEDLDDDDPKFINVGEKAYSCALKSGKLVTA      1 - 70
VSNNTIQVHTFPEGVPDGILTRFTTNANHVVFNGDGTKIAAGSSDFLVKIVDVMDSSQQKTFRGHDAPVL     71 - 140
SLSFDPKDIFLASASCDGSVRVWQISDQTCAISWPLLQKCNDVINAKSICRLAWQPKSGKLLAIPVEKSV    141 - 210
KLYRRESWSHQFDLSDNFISQTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLA    211 - 280
WHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVEIPSFS    281 - 350
KGIINDDEDDEDLMMASGRPRQRSHILEDDENSVDISMLKTGSSLLKEEEEDGQEGSIHNLPLVTSQRPF    351 - 420
YDGPMPTPRQKPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATHLSNTLNYTIA    421 - 490
DLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIIDLPQNEDIEAICLGQGWAAAATSALLLRLFTIG    491 - 560
GVQKEVFSLAGPVVSMAGHGEQLFIVYHRGTGFDGDQCLGVQLLELGKKKKQILHGDPLPLTRKSYLAWI    561 - 630
GFSAEGTPCYVDSEGIVRMLNRGLGNTWTPICNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPT    631 - 700
LPRPAVAILSFKLPYCQIATEKGQMEEQFWRSVIFHNHLDYLAKNGYEYEESTKNQATKEQQELLMKMLA    701 - 770
LSCKLEREFRCVELADLMTQNAVNLAIKYASRSRKLILAQKLSELAVEKAAELTATQVEEEEEEEDFRKK    771 - 840
LNAGYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDVSAKSGAVTFSSQGR    841 - 910
VNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALSRTTNNEKSPIIKPLIPKPKPKQASAASYFQ    911 - 980
KRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEG    981 - 1050
MIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQK   1051 - 1120
LSAFAFKQE                                                                1121 - 1129
//

Text Mined References (36)

PMID Year Title
26082189 2015 And-1 coordinates with Claspin for efficient Chk1 activation in response to replication stress.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25602958 2015 RecQL4 is required for the association of Mcm10 and Ctf4 with replication origins in human cells.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24255107 2013 Interaction between human Ctf4 and the Cdc45/Mcm2-7/GINS (CMG) replicative helicase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184928 2013 Acidic nucleoplasmic DNA-binding protein (And-1) controls chromosome congression by regulating the assembly of centromere protein A (CENP-A) at centromeres.
23093411 2012 The involvement of acidic nucleoplasmic DNA-binding protein (And-1) in the regulation of prereplicative complex (pre-RC) assembly in human cells.
22570476 2012 Okazaki fragment processing-independent role for human Dna2 enzyme during DNA replication.
More...