Property Summary

NCBI Gene PubMed Count 29
PubMed Score 209.83
PubTator Score 18776.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.122 1.1e-02
adult high grade glioma 1.100 3.7e-03
atypical teratoid / rhabdoid tumor 1.300 3.0e-04
Breast cancer 2.800 2.8e-02
colon cancer 1.300 5.8e-03
glioblastoma 1.100 5.5e-05
group 3 medulloblastoma 1.100 3.1e-03
intraductal papillary-mucinous carcinoma... 1.400 3.5e-03
intraductal papillary-mucinous neoplasm ... 1.700 9.9e-04
lung adenocarcinoma 1.100 9.7e-06
lung cancer 2.300 4.1e-04
malignant mesothelioma 2.200 8.4e-07
medulloblastoma, large-cell 1.400 1.4e-05
non-small cell lung cancer 1.180 2.5e-17
osteosarcoma -1.848 7.0e-04
ovarian cancer 1.100 4.7e-04
primitive neuroectodermal tumor 1.100 3.9e-03
psoriasis -1.700 3.7e-04
spina bifida -1.016 4.4e-02

 GO Function (1)

 GO Component (2)

Gene RIF (19)

AA Sequence

MPATRKPMRYGHTEGHTEVCFDDSGSFIVTCGSDGDVRIWEDLDDDDPKFINVGEKAYSCALKSGKLVTA      1 - 70
VSNNTIQVHTFPEGVPDGILTRFTTNANHVVFNGDGTKIAAGSSDFLVKIVDVMDSSQQKTFRGHDAPVL     71 - 140
SLSFDPKDIFLASASCDGSVRVWQISDQTCAISWPLLQKCNDVINAKSICRLAWQPKSGKLLAIPVEKSV    141 - 210
KLYRRESWSHQFDLSDNFISQTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLA    211 - 280
WHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVEIPSFS    281 - 350
KGIINDDEDDEDLMMASGRPRQRSHILEDDENSVDISMLKTGSSLLKEEEEDGQEGSIHNLPLVTSQRPF    351 - 420
YDGPMPTPRQKPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATHLSNTLNYTIA    421 - 490
DLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIIDLPQNEDIEAICLGQGWAAAATSALLLRLFTIG    491 - 560
GVQKEVFSLAGPVVSMAGHGEQLFIVYHRGTGFDGDQCLGVQLLELGKKKKQILHGDPLPLTRKSYLAWI    561 - 630
GFSAEGTPCYVDSEGIVRMLNRGLGNTWTPICNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPT    631 - 700
LPRPAVAILSFKLPYCQIATEKGQMEEQFWRSVIFHNHLDYLAKNGYEYEESTKNQATKEQQELLMKMLA    701 - 770
LSCKLEREFRCVELADLMTQNAVNLAIKYASRSRKLILAQKLSELAVEKAAELTATQVEEEEEEEDFRKK    771 - 840
LNAGYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDVSAKSGAVTFSSQGR    841 - 910
VNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALSRTTNNEKSPIIKPLIPKPKPKQASAASYFQ    911 - 980
KRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEG    981 - 1050
MIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQK   1051 - 1120
LSAFAFKQE                                                                1121 - 1129
//

Text Mined References (42)

PMID Year Title