Property Summary

Ligand Count 8
NCBI Gene PubMed Count 20
PubMed Score 71.46
PubTator Score 19.43

Knowledge Summary

Patent (3,613)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.300 1.9e-02
osteosarcoma -1.072 1.0e-02
ovarian cancer 1.100 6.5e-09
psoriasis -1.600 9.9e-05

Gene RIF (2)

AA Sequence

MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHR      1 - 70
LFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH     71 - 140
AKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHC    141 - 210
VIDERTDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSALRQLLNSMMTVDPHQR    211 - 280
PHIPLLLSQLEALQPPAPGQHTTQI                                                 281 - 305
//

Text Mined References (21)

PMID Year Title