Property Summary

NCBI Gene PubMed Count 20
Grant Count 1
Funding $358,953
PubMed Score 72.24
PubTator Score 19.43

Knowledge Summary

Patent (3,613)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.319 0.000
lung cancer 1.300 0.019
ovarian cancer 1.100 0.000

Synonym

Accession O75716 A8K9H9 Q5U0F8 Q96KI2 Q9BUH4 Q9UEN3 Q9UP78
Symbols PSK
KRCT
MPSK
TSF1
hPSK
PKL12

Gene

 Grant Application (1)

PDB

2BUJ  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (2)

PMID Text
25084525 MAL2 and STK16 function to sort secretory soluble cargo into the constitutive secretory pathway in hepatocytes.
16310770 The Endogenous STK16 subcellular localization was evaluated by indirect immunofluorescence in NRK cells, demonstrating a Golgi-associated pattern that appears to be independent of signals provided by integrin pathways.

AA Sequence

MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHR      1 - 70
LFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH     71 - 140
AKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHC    141 - 210
VIDERTDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSALRQLLNSMMTVDPHQR    211 - 280
PHIPLLLSQLEALQPPAPGQHTTQI                                                 281 - 305
//

Text Mined References (21)

PMID Year Title
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
25084525 2014 Serine/threonine kinase 16 and MAL2 regulate constitutive secretion of soluble cargo in hepatic cells.
19060904 2009 An empirical framework for binary interactome mapping.
18184589 2008 Structure of the human protein kinase MPSK1 reveals an atypical activation loop architecture.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16310770 2006 Nucleocytoplasmic shuttling of STK16 (PKL12), a Golgi-resident serine/threonine kinase involved in VEGF expression regulation.
More...