Property Summary

NCBI Gene PubMed Count 16
PubMed Score 72.19
PubTator Score 16.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Favism 4 3.702 1.9
Keshan disease 17 3.244 1.6

Gene RIF (8)

AA Sequence

MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVA      1 - 70
TYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPSFQLFEKGDV     71 - 140
NGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTD    141 - 210
ILAYLKQFKTK                                                               211 - 221
//

Text Mined References (17)

PMID Year Title