Property Summary

NCBI Gene PubMed Count 60
PubMed Score 133.87
PubTator Score 105.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 6.022 3.0
Palmoplantar keratosis 74 0.0 4.0
Disease Target Count
Bullous ichthyosiform erythroderma 4

Expression

  Differential Expression (10)

Disease log2 FC p
colon cancer 1.800 1.7e-02
interstitial cystitis -1.200 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.300 6.1e-03
non-small cell lung cancer 2.067 4.2e-13
osteosarcoma 1.171 3.5e-06
ovarian cancer 1.500 4.6e-06
pancreatic cancer 1.600 9.8e-08
pancreatic ductal adenocarcinoma liver m... 1.036 4.0e-02
spina bifida -1.375 2.7e-02
ulcerative colitis 1.300 1.6e-03

Gene RIF (46)

AA Sequence

MDWKTLQALLSGVNKYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGCTNVCYDNYFP      1 - 70
ISNIRLWALQLIFVTCPSLLVILHVAYREERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLI     71 - 140
IEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIVLTICELCYLI    141 - 210
CHRVLRGLHKDKPRGGCSPSSSASRASTCRCHHKLVEAGEVDPDPGNNKLQASAPNLTPI              211 - 270
//

Text Mined References (61)

PMID Year Title